KEGG   Xanthobacter autotrophicus: Xaut_1759Help
Entry
Xaut_1759         CDS       T00581                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xau  Xanthobacter autotrophicus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Xaut_1759
Enzymes [BR:xau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Xaut_1759
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Xaut_1759
Lipid biosynthesis proteins [BR:xau01004]
 Fatty acid synthase
  Component type
   Xaut_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1983598..1984239
Genome map
AA seq 213 aa AA seqDB search
MAALGLFTFASGLPGPGAASAAEARTVRIVAFGDSLTAGYGLPASAAFPVQLEAALKAKG
LDVSVENAGVSGETASQGLARLDWSIREGTDAVIVELGANDMLRGLNPATTRKALTEIVQ
RLKGRGITVLLAGMKAAPNLGRPYQETFDAIFPELAAAEGVLLYPFFLDGVAGERALVQP
DGLHPTAEGVRRIVSGILPKAEELVAQVQAKGK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctcggcctgttcacgttcgcgtcaggccttcctgggccgggagccgcctcg
gcggccgaggcccggacggtacgcatcgtcgccttcggcgacagcctcaccgccggctac
ggactgcccgccagcgctgccttcccggtccagctggaggcggcgctgaaggccaaggga
ctcgacgtgagcgtcgagaatgccggtgtctccggcgagaccgcgtcccagggcctcgcc
cggctcgactggtccatccgcgagggcaccgacgcggtgatcgtggagctgggcgccaac
gacatgctgcgcggcctcaaccccgccaccacgcgcaaggcgctgaccgagatcgtccag
cggctgaaggggcgcggcatcaccgtgctgctggccggcatgaaggccgcgcccaacctg
ggcaggccctatcaggagacgttcgacgccatcttcccggaactcgccgcggcggaggga
gtgctgctctatcccttcttcctcgacggcgtggccggcgagcgcgcgctggtgcagccg
gacggcctccatcccacggccgagggcgtcaggcgcatcgtctccggcatcctgcccaag
gcggaggagctggtggcgcaggttcaagccaaggggaaatag

DBGET integrated database retrieval system