KEGG   Xanthobacter autotrophicus: Xaut_1792Help
Entry
Xaut_1792         CDS       T00581                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
xau  Xanthobacter autotrophicus
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xau00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xau02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2021368..2021766)
Genome map
AA seq 132 aa AA seqDB search
MIRAAFVSALLLAAATGSALADPDVAKGETTFKKCMACHAIGPDAKVKVGPPLNGIVGAK
WAHFEGYAYSADIKDGAAAGKVWDEATLDNYISNPKVLAPKGKMAFAGVKNDDERKDLIA
FLAQFNADGSKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgccgcattcgtttccgccctgctcctggccgccgccaccggctccgcgctc
gcggacccggacgtggccaagggcgagaccaccttcaagaagtgcatggcgtgccacgcc
atcggccccgacgccaaggtgaaggtcggcccgcccctgaacgggatcgtcggcgccaag
tgggcccacttcgagggctatgcctattccgccgacatcaaggacggcgccgccgccggc
aaggtgtgggacgaggccaccctggacaattacatcagcaaccccaaggtgctcgccccc
aagggcaaaatggccttcgccggcgtcaagaacgacgacgagcgcaaggacctcatcgcc
ttcctcgcccagttcaatgccgacggcagcaagaagtaa

DBGET integrated database retrieval system