KEGG   Xanthobacter autotrophicus: Xaut_1792Help
Entry
Xaut_1792         CDS       T00581                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
xau  Xanthobacter autotrophicus
Pathway
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
xau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xau00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Xaut_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABS67037
JGI: Xaut1792
UniProt: A7IG94
Position
complement(2021368..2021766)
Genome map
AA seq 132 aa AA seqDB search
MIRAAFVSALLLAAATGSALADPDVAKGETTFKKCMACHAIGPDAKVKVGPPLNGIVGAK
WAHFEGYAYSADIKDGAAAGKVWDEATLDNYISNPKVLAPKGKMAFAGVKNDDERKDLIA
FLAQFNADGSKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgccgcattcgtttccgccctgctcctggccgccgccaccggctccgcgctc
gcggacccggacgtggccaagggcgagaccaccttcaagaagtgcatggcgtgccacgcc
atcggccccgacgccaaggtgaaggtcggcccgcccctgaacgggatcgtcggcgccaag
tgggcccacttcgagggctatgcctattccgccgacatcaaggacggcgccgccgccggc
aaggtgtgggacgaggccaccctggacaattacatcagcaaccccaaggtgctcgccccc
aagggcaaaatggccttcgccggcgtcaagaacgacgacgagcgcaaggacctcatcgcc
ttcctcgcccagttcaatgccgacggcagcaagaagtaa

DBGET integrated database retrieval system