KEGG   Xanthobacter autotrophicus: Xaut_1849Help
Entry
Xaut_1849         CDS       T00581                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
xau  Xanthobacter autotrophicus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Xaut_1849
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Xaut_1849
Enzymes [BR:xau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Xaut_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2080362..2081867)
Genome map
AA seq 501 aa AA seqDB search
MDAKRGPMTSLSLGQLLDGHARILSAGAGDEPVFGLSADSRRINPGDLFVAIPGTHADGS
RFIADAVARGASAVLMEPAAPRPVLPPHVALAFSLDVRHSLSLAAARFYPRQPATIAAVT
GTAGKTSVAFFLRQIWERLGHKAAYLGTIGLVAPDGSTYGSLTTPDPVELHATLDRLAGE
GVTHMALEASSHGLDQKRLDGVHFTAGGFTNLGRDHLDYHPTIDAYFRAKLRLFTQVMPD
DATAVAVTGAPFAANALAWAETRGLKLLPIGEGQATGLDIFGTTGSGTGQKVMFADGSHA
IVPLVGRFQLDNALLAAGLAIACGAERPAALEALAYLTGVPGRLERIGDDPRRPVFVDYA
HKPEALATVLDTLRAAVPGRLMVVFGCGGDRDKGKRPLMGAIAASKADVVIVTDDNPRSE
DPAAIRAEILEGAHGAREIGDRAEAIKAAVALLQPGDALIVAGKGHETGQIIGDRTYPFS
DAAEVRAALESGSGSPSLNLG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggatgccaaaagaggtccgatgaccagcctttccctcggacagctcctcgacggccac
gcccgtatcctatccgccggcgcgggcgacgagcccgtcttcggcctctccgccgacagc
cgcaggatcaatcccggcgacctcttcgtcgccattcccggcacccatgcggacggcagc
cgcttcatcgccgatgcggtggcgcgcggcgcttcggcggtgctgatggagcccgccgcg
ccccggccggtgctgccgccccatgtggcgcttgccttctccctcgacgtgcggcactcc
ctgtcgctggcggcggcgcgcttctatccgcgccagccggccaccatcgcggcggtgacc
gggacggcgggcaagacctcggtcgccttcttcctgcggcagatctgggagcggctcggc
cacaaggcggcttatttgggcaccattggcctggtggcgccggacggctccacctatggc
agcctcaccacccccgatccggtggagctgcacgccaccctcgaccgcctcgccggcgag
ggtgtcacccacatggcgctggaggcctcgtcccacgggctggaccagaagcggctcgac
ggtgtgcacttcactgccggcggcttcaccaatctcggccgcgaccatctggactaccac
cccaccatcgacgcctatttccgggccaagctccgcctcttcacccaggtgatgccggat
gacgccaccgccgtggcggtgaccggcgcgccatttgctgccaatgcgctggcctgggct
gagacgcgcggcctgaagctgctgcccatcggcgaggggcaggcaaccggtctcgacatc
ttcggcaccacggggtccggcaccgggcagaaggtgatgttcgccgacggcagtcatgcc
atcgtgccgctggtgggccgcttccagctcgacaacgctttgctcgccgccggccttgcc
attgcctgcggggcggagcggccggcggcgctggaggccctcgcatatctgaccggcgtg
cccggccggctggagcgcatcggcgacgatccgcgccggcccgtgttcgtggactacgcc
cacaagcccgaggcgctggccaccgtgctcgacaccctgcgcgcggcggtgccggggcgg
ctcatggtggtgttcggctgcggcggcgaccgggacaagggcaagcgccccctcatgggc
gccatcgccgcctccaaggcggacgtggtgatcgtcaccgacgacaatccccgcagcgag
gaccccgccgccatccgcgccgaaatcctggaaggtgcccacggcgccagggaaatcggc
gaccgggcggaggccatcaaggcggccgtggcgctgcttcagcctggggatgcgctcatt
gttgccggcaagggtcacgaaaccggccaaatcatcggcgaccggacatatccgttctcg
gacgcggcggaagtccgtgccgctcttgagtcgggttccgggagtccgtctctcaatttg
gggtaa

DBGET integrated database retrieval system