KEGG   Xanthobacter autotrophicus: Xaut_1966Help
Entry
Xaut_1966         CDS       T00581                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00020  Citrate cycle (TCA cycle)
xau00190  Oxidative phosphorylation
xau00650  Butanoate metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01200  Carbon metabolism
Module
xau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Xaut_1966
   00650 Butanoate metabolism
    Xaut_1966
  Energy metabolism
   00190 Oxidative phosphorylation
    Xaut_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS YrhC
Motif
Other DBs
NCBI-ProteinID: ABS67210
JGI: Xaut1966
UniProt: A7IGR7
Position
complement(2223885..2224292)
Genome map
AA seq 135 aa AA seqDB search
MSNTPSSGHAPMRTALGRVRGLGSARSGTDHFFKQRVTGLANLILMIAFIGIVISLAGSS
YAATRATLGHPFVAVVILLTLLSVTTHMRIGMQVVIEDYIHTEALKVMLIVANTFFSIAI
ALAGAFAVLKISLGG
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccccgtcctccggacacgcccccatgcgcacggccctcggccgcgtgcgc
ggcctcggctctgcccgctccggcaccgaccatttcttcaagcagcgcgtcaccggcctc
gccaacctgatcctgatgatcgccttcatcgggatcgtcatcagcctcgccggctccagc
tacgcggcgacgcgcgccaccctcggccatccgttcgtggcggtggtcatcctgctgacg
ctgctgtcggtcaccacgcacatgcgcatcggcatgcaggtggtgatcgaggattacatc
cacactgaggcactcaaggtgatgctcatcgtggccaacaccttcttcagcatcgccatt
gccctcgccggcgccttcgccgtgctcaagatcagcctgggaggctga

DBGET integrated database retrieval system