KEGG   Xanthobacter autotrophicus: Xaut_2010Help
Entry
Xaut_2010         CDS       T00581                                 

Definition
alcohol dehydrogenase zinc-binding type 2
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
xau  Xanthobacter autotrophicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Xaut_2010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xaut_2010
  Lipid metabolism
   00071 Fatty acid degradation
    Xaut_2010
  Amino acid metabolism
   00350 Tyrosine metabolism
    Xaut_2010
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xaut_2010
   00626 Naphthalene degradation
    Xaut_2010
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Xaut_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2267184..2268167)
Genome map
AA seq 327 aa AA seqDB search
MLAMVLKRSGDRLVAQERPDPVAGPGEVLIAVTACGVCRTDLHVVDGELPQTVRPIVPGH
EIVGRVAMLGAGVSHLRLGERVGVGWLGHACGTCPYCAAQEENLCDTPAFTGCTRDGGFA
THTVADASFVYPLGEAGDDTALAPLLCAGLIGWRTLKMAGEGRRVGVYGFGAAAHIIAQV
ARFQGREIYAFTRPGDEAAQDFARSLGAVYAGPSDAPAPEPLDAALIFAPAGELVPQALR
AVRKGGRVVCGGIHMSDIPSFPYRWLWEERKILSVANLTRADAHEFLALAPKAGVTTHVT
PYPLAQANEALDDLRHGRLKGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccatggtcctgaagcgcagcggcgacaggttggtcgcgcaggagcggcccgac
ccggtcgcgggaccgggcgaggtgttgatcgcggtcaccgcctgcggcgtctgccgcacc
gacctccatgtggtggacggggaactgccccagaccgtgcgtcccatcgtgcccggccat
gagatcgtcgggcgggtggcgatgctgggtgccggcgtgtcccacctcaggctcggagag
cgggtgggcgtgggctggctcggccacgcctgcggcacctgcccctattgcgccgcgcag
gaggaaaacctctgcgacactcccgccttcaccggctgcacgcgggacggcggcttcgcc
actcacacggtggcggatgccagcttcgtctatcccctcggcgaagcgggcgacgacacc
gcgctggcgccgctgctctgcgccggcctcatcggctggcgcaccctgaagatggcgggg
gaaggccggcgcgtcggcgtctacggcttcggcgcggcggctcacatcatcgcccaggtg
gcccgcttccagggcagggagatctatgccttcacccggcctggggatgaggcggcgcag
gacttcgcccgctccctcggcgccgtctatgccggcccctccgacgcccccgcccccgag
ccgctggacgccgccctcatcttcgctccggcgggggaattggtgccgcaggccctgcgc
gccgtgcgcaagggcggacgcgtggtgtgcggcggcatccatatgagcgacatcccctcc
ttcccctatcgctggctgtgggaggagcggaagatcctgtcggtggcgaacctgacccgg
gcggatgcccacgagttcctggcgctggcccccaaggccggcgtcaccacccatgtgacg
ccctatcccctggcgcaggccaacgaagcgctggacgacctgcgccacggccgcctgaag
ggcgcggccgtgctggtgccgtga

DBGET integrated database retrieval system