KEGG   Xanthobacter autotrophicus: Xaut_2047Help
Entry
Xaut_2047         CDS       T00581                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xau  Xanthobacter autotrophicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xaut_2047
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xaut_2047
   00052 Galactose metabolism
    Xaut_2047
   00500 Starch and sucrose metabolism
    Xaut_2047
   00520 Amino sugar and nucleotide sugar metabolism
    Xaut_2047
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Xaut_2047
   00524 Butirosin and neomycin biosynthesis
    Xaut_2047
Enzymes [BR:xau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Xaut_2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2305161..2306102)
Genome map
AA seq 313 aa AA seqDB search
MAPTVLLADIGGTTTRIARAGVDGIPFDIRLEANDSYGSIEDLLKTYLDSLGGEPPRCAA
LAVAGPIDGDGVRLTNRNWRFSTQALAQELSFARLTVLNDFEALAHGLPLLTRDDLMEVG
TGRRVPGAPMLLSGPGTGLGTALILPREDGYEVLASEAGHMRLGAVTTDEARIVAHLVRD
LGPVAVEHVLSGPGLVRLHRILSGEQLSSHAIIKAALDGQRQEKESCHIFLRLLGRVLGD
LALAFDAKGGVYVGGGIGRAMAPLFAESPFRTAFEEHPPYLDRLSLIPIHVVTHATPGLI
GIGEIGRRLLVDD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaccgtattgcttgcggacatcggcggaaccaccacgcgcatcgcccgcgcc
ggcgtggacggcataccgttcgacatccgtctcgaggccaatgattcctacgggtccatc
gaggacctgctgaagacctatctcgactcgctgggcggcgaaccgcctcgctgcgcggcg
ctggccgtggccggtcccatcgacggcgacggcgtgcggctgaccaaccggaactggcgc
ttctccacgcaggcactggcccaggagctgtctttcgcgcggctcacggtgctcaacgac
ttcgaggccctcgcccacggcctgccgctgctgacccgcgacgacctgatggaagtgggc
accggccgccgcgtccccggcgcgcccatgctgctgtcgggccccggaaccgggctcggc
accgcgctgatcctgccgcgggaagacggctacgaggtgcttgcgagcgaagccggccac
atgcgcctcggcgccgtgaccacggacgaggcccgcatcgtcgcccacctggtgcgcgac
ctggggccggtggcggtggagcacgtcctgtccgggccggggctggtgcggctgcatcgc
atcctctccggcgagcaattgtcctcccacgccatcatcaaggcggcgctggacggccag
cggcaggaaaaggagagctgccacatcttcctgcgcctgctcggccgggtgctgggggac
cttgccctcgccttcgatgccaagggtggcgtctatgtgggcggcggcatcggccgggcc
atggcgcctttgttcgccgaaagcccgttccggacggcgttcgaggagcatccgccctat
ctcgaccggctgtcgctcatccccatccatgtggtgacgcacgccacccccggcctgatc
ggcatcggcgagatcggccggcggctgctggtggacgactag

DBGET integrated database retrieval system