KEGG   Xanthobacter autotrophicus: Xaut_2093Help
Entry
Xaut_2093         CDS       T00581                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00300  Lysine biosynthesis
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
xau01230  Biosynthesis of amino acids
Module
xau_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Xaut_2093
Enzymes [BR:xau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Xaut_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABS67337
JGI: Xaut2093
UniProt: A7IH44
Position
complement(2353572..2354663)
Genome map
AA seq 363 aa AA seqDB search
MTPHADDALELVAKRLEAAGYRVERLTFETGGVPIPNLYARIGTDGPNLCFAGHVDVVPE
GDATQWHHAPFAGTVEDGVLHGRGAVDMKGAVAAFLAAALAFGRPQRGSLSFLITGDEEG
PALDGTVKVVEWLKARGETIDHCVLGEPTNPDALGDAFKVGRRGSLSGILTVKGVQGHVA
YPHLADNPIPRLLKLIGDLTAAPLDHGSDFFPPSNLEVVSVDVGNPVFNLIPAQATARFN
VRFNDLFSLESLKSEIIRRLDGAGLTYDLAFQTGASQSFLTAPGPFTDLVASAVEEVTGR
RPEPSTSGGTSDARFIKDICPVVEFGLVGRTMHKVDEATPVKDIEALTAIYGRIIARYFS
TFA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgcacgcggacgatgcgctggagctggtggcgaaaaggctggaggccgctggg
taccgcgtggagcgcctgaccttcgagaccggcggcgtgcccatccccaatctctacgcc
cgtatcggcaccgacggcccgaacctgtgcttcgccgggcatgtggacgtggtacccgag
ggagatgccacccaatggcaccacgcccccttcgccggcacggttgaggacggcgtgctc
catgggcgtggggcggtggacatgaagggggcggtggccgccttcctcgccgccgcgctc
gccttcggccggccgcagcgcggcagcctctccttcctcatcaccggcgacgaggaaggc
ccggcgctggacggcaccgtgaaggtggtggagtggctgaaggccaggggcgagaccatc
gaccattgcgtgctgggcgagcccaccaaccccgatgccctgggcgatgccttcaaggtc
ggccggcgcggcagcctctccggcatcctcaccgtgaagggcgtgcaggggcacgtggcc
tatccgcaccttgccgacaatcccattccgcgcctcctgaagctcatcggcgacctgacc
gccgcccccctcgaccacggctcggatttcttcccgccctccaacctggaggtggtctcg
gtggacgtgggcaatccggtattcaacctgatccccgcgcaggccaccgcccgcttcaac
gtgcgcttcaacgacctgttctcgctggagagcctgaagtccgagatcatccgccgcctc
gacggcgccggcctcacctacgacctcgcattccagaccggggcgagccagagcttcctc
accgcccccggcccgttcacggacctcgtcgccagcgcggtggaagaggtgaccgggcgc
cggcccgagccctccacctcgggcggcacctcggatgcgcgcttcatcaaggacatctgc
ccggtggtggaattcggcctcgtgggccgcaccatgcacaaggtggacgaggcgacgccg
gtcaaggacatcgaggctctcaccgccatctacggccgcatcatcgcccgctatttctca
accttcgcgtga

DBGET integrated database retrieval system