KEGG   Xanthobacter autotrophicus: Xaut_2493Help
Entry
Xaut_2493         CDS       T00581                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xau  Xanthobacter autotrophicus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2784749..2785189)
Genome map
AA seq 146 aa AA seqDB search
MAKVVAEYDAAAVIMHNRTEVDESLDIVADMLDFFAKALDTADKAGVKRERLVLDPGIGF
GKSFPQNLSAIRRLGELRVLGLPILLGASRKSLIGKVIDTVPAERLPGTIASNVIAIMAG
VEIIRVHDVAAHVQAARVAEAIRDAS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagtggtggcggagtacgacgccgccgctgtcatcatgcataaccgaaccgaa
gtcgatgaatccctcgatatcgtcgccgatatgctggacttcttcgcgaaagctctcgat
acggccgacaaggcgggcgtgaagcgcgagcgtctggtgctcgaccccggcatcggcttc
ggcaagagcttcccgcagaacctctccgccatccgccgcctcggcgagctccgcgtgctg
ggactgccgatcctgctcggcgcgtcgcgcaagtccttgatcggaaaggtgattgatacc
gtgccggcggaacgcctgccgggcaccatcgcctccaacgtcatcgccatcatggccggg
gtggagatcatccgggtgcatgacgtagccgcccatgtgcaggcggcgcgcgtcgccgag
gccatccgggacgcctcgtga

DBGET integrated database retrieval system