KEGG   Xanthobacter autotrophicus: Xaut_2631Help
Entry
Xaut_2631         CDS       T00581                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
xau  Xanthobacter autotrophicus
Pathway
xau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xau00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Xaut_2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABS67873
JGI: Xaut2631
UniProt: A7IIN0
Position
2919437..2919982
Genome map
AA seq 181 aa AA seqDB search
MDFFELNKIAGAVLGTLALTLGLGIASQILFTPEAPAKPGFDIVVQEGAAGGAAPAKAAE
VPIEQLFATASVEKGAAVAKKCAACHNFQEGAGAKVGPDLYGVVGRPVASAAGFAYSAAM
KAKGGDWTALALNTFLTSPKTAVPGTAMAFAGIPKEAERADLIAYLNSLSHDPKPLPTAA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggacttttttgaattgaacaagattgcaggtgcggttctgggcaccctggcgctcacc
ctcgggctggggatcgcgtcgcagatcctgttcacgcctgaggcgcccgccaagcccggc
ttcgatatcgtcgtgcaggaaggcgccgccggcggcgccgccccggccaaggccgcggaa
gtgccgatcgagcagctgttcgctaccgcctccgtcgagaagggcgcggccgtcgccaag
aagtgcgccgcctgccacaacttccaggaaggcgccggcgccaaggtggggccggacctc
tatggcgtcgtgggccgcccggtggcttcagctgcgggctttgcctattccgccgccatg
aaggcgaagggcggcgactggacggcccttgccctcaacaccttcctgaccagcccgaag
accgcggtgcccggcaccgccatggccttcgccggcatcccgaaggaagccgagcgggcg
gacctcatcgcctatctcaacagcctctcccacgatcccaagccgctgccgaccgccgcg
aagtag

DBGET integrated database retrieval system