KEGG   Xanthobacter autotrophicus: Xaut_2631Help
Entry
Xaut_2631         CDS       T00581                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
xau  Xanthobacter autotrophicus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Xaut_2631
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Xaut_2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2919437..2919982
Genome map
AA seq 181 aa AA seqDB search
MDFFELNKIAGAVLGTLALTLGLGIASQILFTPEAPAKPGFDIVVQEGAAGGAAPAKAAE
VPIEQLFATASVEKGAAVAKKCAACHNFQEGAGAKVGPDLYGVVGRPVASAAGFAYSAAM
KAKGGDWTALALNTFLTSPKTAVPGTAMAFAGIPKEAERADLIAYLNSLSHDPKPLPTAA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggacttttttgaattgaacaagattgcaggtgcggttctgggcaccctggcgctcacc
ctcgggctggggatcgcgtcgcagatcctgttcacgcctgaggcgcccgccaagcccggc
ttcgatatcgtcgtgcaggaaggcgccgccggcggcgccgccccggccaaggccgcggaa
gtgccgatcgagcagctgttcgctaccgcctccgtcgagaagggcgcggccgtcgccaag
aagtgcgccgcctgccacaacttccaggaaggcgccggcgccaaggtggggccggacctc
tatggcgtcgtgggccgcccggtggcttcagctgcgggctttgcctattccgccgccatg
aaggcgaagggcggcgactggacggcccttgccctcaacaccttcctgaccagcccgaag
accgcggtgcccggcaccgccatggccttcgccggcatcccgaaggaagccgagcgggcg
gacctcatcgcctatctcaacagcctctcccacgatcccaagccgctgccgaccgccgcg
aagtag

DBGET integrated database retrieval system