KEGG   Xanthobacter autotrophicus: Xaut_2809Help
Entry
Xaut_2809         CDS       T00581                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xau  Xanthobacter autotrophicus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xau00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3129779..3131272
Genome map
AA seq 497 aa AA seqDB search
MAAYILAIDQGTTSSRALLVRRDGTIAALAQEELPQHFPASGEVEQEAEDIWNTVLSCCR
VVLRQAGVGPSDIAAIGITNQRETTLVWERATGRAIHRAIVWQDRRTADTCARLEAEGHG
ALIRARTGLLIDPYFSATKIAHILEKVPGARARAEKGELAFGTVDSFLLFRLTGGRVHAT
DATNASRTMLFDIHKGAWDDDLLALFGVPRALLPEVRDCAAEFGATDPEMFGAPIPIRGM
AGDQQAAMVGQACFQPGMVKSTYGTGCFALLNTGETPVASRHRLITTIAYQIEGRRTYAL
EGSIFVAGAAVQWLRDGLKMISHAAESDRLAAEADEGQDVILVPAFVGLGAPYWRPQVRG
ALFGLTRATGPAELARAALEAVCFQTCDLIDAMHADWPGQSGATVLRVDGGMSASDFTMQ
RLADLLGAPVDRPAETETTVLGAAYLAGLQCGFFPPPDIFAQGWRLERRFVPAMADEVRA
MRLAAWRSAVECLIGRD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcctacatcctcgccatcgaccagggcaccacctcctcccgcgccctgctggtg
cggcgcgacggcaccatcgcggcgctggcgcaggaggagctaccccagcattttccggcc
tccggcgaggtggagcaggaagcggaggacatctggaatacggtgctttcctgctgccgc
gtggtgctgcggcaggcaggggtggggccatccgacattgccgccatcggcatcaccaac
cagcgcgagacgacgctggtgtgggagcgcgccaccggccgcgccatccaccgcgccatc
gtctggcaggaccggcgcacggccgacacctgcgcccgccttgaggcggagggccatggc
gcgctgatccgcgctcgcaccggcttgctcatcgatccctatttctccgccaccaagatc
gcccacatcctcgaaaaggtgccgggcgcccgcgcgcgggcggagaagggcgaactggcc
ttcggcacggtggacagtttcctcctgttccgcctcaccggcggccgggtgcatgccacc
gacgccaccaatgcgtcgcgcaccatgctgttcgatatccataagggggcctgggacgac
gacctgctggccctgttcggggtgccgcgcgcgctgctgccggaggtgcgcgattgcgcg
gccgaattcggcgccaccgatccggagatgttcggcgcgcccattcccatccgcggcatg
gcaggcgaccagcaggcagccatggtggggcaggcgtgcttccagccgggcatggtgaaa
tccacctacggcaccggctgcttcgccctgctcaacacgggcgaaacgccggtggcctca
cgccatcgcctcatcaccaccatcgcctaccagatcgaagggcggcgcacctatgcgctg
gaaggctcgatcttcgtggccggcgcggcggtgcaatggctgcgcgacgggctgaagatg
atctcccatgccgccgagagcgaccgcctcgccgccgaggcggacgaggggcaggacgtg
atcctggtgccggccttcgtgggccttggcgcgccctattggcggccacaggtgcgcggc
gccctgttcggcctcacccgcgccaccggaccggccgagctggcgcgggcggcgctggag
gcggtgtgcttccagacctgcgacctcatcgatgccatgcatgcggactggccggggcaa
agcggtgccaccgtgctgcgggtggacggcggcatgtcggcctccgacttcaccatgcag
cgcctcgccgacctcctcggcgcgccggtggaccgtccggcggagacggagaccacggtg
ctgggcgccgcctatctcgcgggcctgcagtgtggcttcttcccgccgccggatatcttc
gcgcagggctggcggctggagcggcggttcgtgccggccatggcggacgaggtgcgcgcc
atgcggctcgcggcctggcgctccgccgtggaatgcctcatcggcagggattga

DBGET integrated database retrieval system