KEGG   Xanthobacter autotrophicus: Xaut_2819Help
Entry
Xaut_2819         CDS       T00581                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Xaut_2819
Enzymes [BR:xau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Xaut_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ABS68059
JGI: Xaut2819
UniProt: A7IJ66
Position
complement(3140782..3141729)
Genome map
AA seq 315 aa AA seqDB search
MTLFALPNHPVPDGCVTGELVAEDGVKLRFARWAPESGSVKGTVALFGGRCEFIEKYFEV
VRELRSRGFAVAMVDWRGQGGSQRLLRNRLKGHVPRFSDYLLDLEVFAREVMLPDCPPPH
FALGHSMGGTILLSSVLDGQRWFDRMVLTAPMLGLDAVPFEDFVRPLSSLLAHMGFARAY
VPGGHGRTISRMRFEGNLLTSDRARFERTQALVKAFPELDLGAPTVGWLAGAEALMAELT
HPDTISRIRQPLLIIAAGGERLVSNKAIEHFSARLIAGAHVVVPASRHELMMEKDIFRAQ
FWAAFDAFIPGTPIL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacattgttcgcccttccgaaccatccggtgccagacggctgcgtcaccggcgaactc
gtcgccgaagacggcgtgaagctgcggtttgcccgctgggcgcccgagagcggcagtgtg
aagggcaccgtcgccctgtttggcgggcgctgtgaattcatcgagaaatatttcgaggtg
gtgcgcgagctgcgttcccgcggctttgccgtggccatggtggactggcgcggccagggc
ggctcccagcgcctgctgcgcaaccggttgaaggggcacgtgccccgcttctcggactat
ctgctggacctcgaggtgttcgcccgcgaggtgatgctacccgattgcccgccgccccac
ttcgcgctgggccattccatgggcggcaccatccttttgtcctcggtgctggacggccag
cgctggttcgaccgcatggtgctcaccgcccccatgctgggactggatgcggtgccgttc
gaggacttcgttcgcccgctgtcgtcgctgctcgcccatatgggcttcgcccgcgcctat
gtgcccggcggccacggcaggacgatctcgcgcatgcggttcgaaggcaatctcctgacc
tcggaccgcgcgcggttcgagcgcactcaggccctcgtcaaagcctttccggagctggac
ctcggcgcgccgaccgtgggctggctcgcaggcgcggaggccctcatggcagagctgaca
catccggacaccatcagccgcatccgccagcccctgctcatcatcgccgccgggggcgag
cggctggtctcgaacaaggccatcgagcatttctcggcccggctcatcgccggcgcccat
gtggtggtgccggccagccgccacgagctgatgatggagaaggacatcttccgcgcccag
ttctgggccgcgttcgatgccttcatccccggaacgccgatcctgtga

DBGET integrated database retrieval system