KEGG   Xanthobacter autotrophicus: Xaut_3067Help
Entry
Xaut_3067         CDS       T00581                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xau  Xanthobacter autotrophicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Xaut_3067
Enzymes [BR:xau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Xaut_3067
DNA repair and recombination proteins [BR:xau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Xaut_3067
    RecFOR pathway proteins
     Xaut_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3406724..3407341
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVVDTLEEDHVILDVHGVGYLVHCSGRTLSALPRAGEAAALFIETHVREDQIRL
FGFSSAAERDWFRLLQGIQGIGTKTALAVLSTLSASELTQAIALGDKTTVARAPGVGPRV
ATRIITELKDKMPGFSASEPLAAQLGGGGVASAQGGAAADAVSALVNLGYGVPQANAAIA
AALRGAGEGAKTEVLIRLGLKELAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaaagttgaagggcgtcgtggacacgctggaggaggaccatgtgatcctcgat
gtccatggcgtgggctatctcgtgcactgttccggccgcacgctctcggccctgccgcgg
gcgggagaggctgcggcgctgttcatcgagacccatgtgcgcgaggaccagatccgcctg
ttcggcttcagctcggcggcggaacgggactggttccgcctgctgcagggcatccagggc
atcggcaccaagaccgccctggccgtgctctccactttgagcgcctcggagctgacgcag
gccatcgcgctgggcgacaagaccacggtggcgcgggctccgggggtggggccgcgggtg
gcgacgcgcatcatcaccgagctgaaggacaagatgccgggcttttccgcctccgaaccg
ctggcggctcagctcggcggcggcggtgtcgcctcggcgcaggggggcgcggcggcggat
gcggtctcggccctggtcaacctcggctatggcgtgccgcaggccaacgctgccatcgcc
gccgccctgcgcggcgcgggggagggggccaagaccgaggttctgatccggctggggctg
aaggaactggcgaagtaa

DBGET integrated database retrieval system