KEGG   Xanthobacter autotrophicus: Xaut_3307Help
Entry
Xaut_3307         CDS       T00581                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
xau  Xanthobacter autotrophicus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:xau00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Xaut_3307
Enzymes [BR:xau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Xaut_3307
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Xaut_3307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3676359..3677240
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLIPVLQGAVIESAEARRPDLRWPLPDNFAERLAGRRVEAIGRRAKYL
LADLDGGEVMILHLGMSGSIRIEGGAVKGRPGRFHHPRGAGGPHDHVVLHLAGGATVTFN
DPRRFGAILIVPYDQIMSHPLLAGLGPEPLGNGFNAEYLARACARRHTSLKAALLDQKLV
AGLGNIYVCEALFRAGLSPRRLAHTIATAEGAPTRRAERLVIAIRDVLREAIHAGGSSLR
DHRQVNGELGYFQHTFKVYDREGQPCQTLHCKDTIRRIVQNGRSTFYCPTCQR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattgcccgaggtggagaccgtccgccgcggtctcattcctgtcctgcaaggt
gccgtgatcgaaagcgcggaggcccgcaggccggacctgcgctggcccttgcccgacaat
ttcgccgagcgccttgccggccgccgggtcgaggccatcggccgtcgcgccaaatatctc
cttgccgatctggacggcggcgaggtgatgatcctgcatctcggcatgtccggctccatc
cgcatcgaaggtggcgcggtgaagggccgccccggccgcttccatcatccgcgcggggcg
ggtggaccgcacgaccacgtggtgctgcacctcgccggcggggcgacggtgaccttcaac
gatccccggcgcttcggcgccatcctgatcgtgccctacgaccagatcatgtcccatccg
ctgctggcgggcctcgggccggagccgctgggcaacggcttcaatgccgaatatctcgct
cgcgcctgcgcccgccgccacacctcgctgaaggcggcgctgctggaccagaagctggtg
gccgggcttggcaacatctatgtgtgcgaggcgctgtttcgcgccggcctgtcgccgcgc
cgcctcgcccacaccatcgccaccgccgagggcgcgcccacccggagggccgagcggctg
gtgatcgccatccgcgacgtgctgcgcgaggcgatccatgccggcggctcctccctgcgc
gaccaccggcaggtgaacggtgagctgggctatttccagcacaccttcaaggtctacgac
cgcgaggggcagccctgccagacactgcactgcaaggacaccatccggcgcatcgtgcag
aatgggcgttcgaccttctactgccccacctgccagaggtag

DBGET integrated database retrieval system