KEGG   Xanthobacter autotrophicus: Xaut_3462Help
Entry
Xaut_3462         CDS       T00581                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xau  Xanthobacter autotrophicus
Brite
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Xaut_3462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3852867..3853952
Genome map
AA seq 361 aa AA seqDB search
MPLSRRLTRAAAIAAGLVALAGLLPALAQERAPDLRAAYAGPPQTWPEPWIDPGVAFVEL
AAAPSPPPSSPEAELGGRLFRDPLLSADGRVACASCHDLAHGFSVPEAVGRGIGGVEGRR
NPPALFAVAGRARLDWDGGGGTLSARVLAPLTAADEMGNAGLVPVMARLSASAHAAAFTR
LFGTEGASPRTLAAVLSAYLETLDTPTRFDRFMAGDRAALSETEVAGLHLFRTRARCANC
HFGPRLTDEKFHNLRLSFFGEPAQDLGRFAVTGDANDAGRFRTASLRHVSESPPFMHNGL
FPTLEGVVNLYDRGGGEVWARNAREAARPLYREAARRSPHLRPLDLTTGEKAALVAFLKA
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgccattgagccgacgactgacccgcgcggcggccatcgcggcggggcttgtggcgctg
gccggtcttctccccgcgctggcgcaagagcgcgcgccggatctgcgcgccgcctatgcc
ggcccgccgcagacatggccggaaccgtggatcgatcccggcgtcgccttcgtggaactc
gccgccgcgccgtcgccaccgccgtcctccccggaggcggaactgggcgggcggctgttc
cgcgatccgctgctctcggccgacggccgcgtcgcctgcgcctcctgccatgatctggcc
catggcttcagcgtgccggaggcggtggggcgcggcatcggcggggtggaggggcgacgc
aatccgccggcgctgtttgccgtcgccggccgtgcgcgcctcgattgggacggcggcggc
gggaccctgtccgctcgcgtgctcgctcctctcaccgccgccgacgaaatgggaaacgcc
ggcctcgtcccggtgatggcgcgcctgtccgccagcgctcatgccgccgctttcacgcgt
cttttcgggacggagggcgcttccccgcgcacgcttgcagcggtgctttccgcctatctg
gagacgctggatacgcccacccgattcgaccgcttcatggccggcgaccgtgccgcgctg
agcgaaacggaagtggccggcctgcacctgttccgcacgagggcgcgctgcgccaattgc
catttcggcccgcgcctcaccgacgagaaattccacaacctgcgcctctccttcttcggc
gagccggcgcaggacctcggccgcttcgctgtcaccggtgacgcgaacgatgcgggacgc
ttccgcacggcctcccttcggcacgtgagcgagagcccgcccttcatgcacaacggcctg
ttccccacgctggagggggtggtgaacctctatgaccggggcggcggcgaagtgtgggcg
cgcaatgcgcgggaggccgcgcgcccgctgtaccgcgaggccgcccggcgctccccgcac
ctgcgcccgctggacctcaccactggggaaaaggcggcgctggtggccttcctgaaggcg
ctgtaa

DBGET integrated database retrieval system