KEGG   Xanthobacter autotrophicus: Xaut_3548Help
Entry
Xaut_3548         CDS       T00581                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00521  Streptomycin biosynthesis
xau00523  Polyketide sugar unit biosynthesis
xau01130  Biosynthesis of antibiotics
Module
xau_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Xaut_3548
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Xaut_3548
Enzymes [BR:xau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Xaut_3548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABS68776
JGI: Xaut3548
UniProt: A7IL83
Position
complement(3959107..3959673)
Genome map
AA seq 188 aa AA seqDB search
MTAFQALDLPEVILVTPRRFGDARGYFCETYVKPLYAANGIVADFVQDNESLSALPGTVR
GLHMQAPPFAQAKLVRVLSGAIFDVAVDVRKGSPTYGRWAGARLTAEGGEQLFVPQGFAH
GFCTLAPDTRVAYKVDAFYDRASECGIIWNDPDLAIDWRFTGETILSDKDRILPRLKDFD
SPFVHSNG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacggcctttcaagcgctcgacctgccagaggtcatcctcgtgacgccgcgccgcttc
ggcgacgcgcgcggctatttctgcgaaacctacgtcaagccgctctatgcggcgaacggg
atcgtcgccgatttcgtacaggacaacgaatcgctgtcggcgctgccgggcacggtgcgc
ggcctccacatgcaagcgccccccttcgcgcaggccaagctggtgcgggtgctgagcggc
gccatcttcgacgtggcggtggatgtgcggaagggctcgcccacctacggccgctgggcc
ggcgcccgcctcaccgccgagggcggcgaacagctgtttgtgccgcagggtttcgcccac
ggcttctgcaccctcgcccccgacacgcgcgtcgcctataaggtggacgcgttttatgat
cgggcgagcgaatgcgggattatctggaacgatcccgacctcgccatcgactggcgcttc
accggcgagaccattctctccgacaaggaccggatattgcctcgcctcaaggatttcgac
agtcccttcgtgcattcgaacggatag

DBGET integrated database retrieval system