KEGG   Xanthobacter autotrophicus: Xaut_4234Help
Entry
Xaut_4234         CDS       T00581                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xau  Xanthobacter autotrophicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4695007..4695669
Genome map
AA seq 220 aa AA seqDB search
MIDFVELRRGMVDGQVRTNNVTDPRIVAAMLEIPREKFVPAPLKSLAYIDDDLALTSGNA
PRYLIEPMILARLVQLADVQEHEHVLDVGTGTGYSAAVLSRLAQQVVAVEEDAGLAATAT
ATLAELGVGNVAVMQGPLNAGWAAEAPYDLILLNGAVDEVPANLFAQVKEGGRVVAVVGH
GGAGQARVFTKVAGAMSERVAFNAAVPALPGFKAAPRFVF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttcgtcgagcttcgccgcggcatggtggacgggcaggtccgcaccaacaac
gtcaccgatccgcgcatcgtcgccgccatgctggagatcccgcgcgagaagttcgtgccg
gcgccgctgaagtccctcgcatatatcgacgacgatctggcgctcacctccggcaatgcc
ccgcgctatctcatcgagcccatgattctcgcgcgcctggtgcagctcgccgacgtacag
gagcatgagcacgtgctcgatgtgggcaccggcaccggctattcggccgccgtgctgtcg
cgcctcgcgcagcaggtggtcgccgtggaggaagacgccggcctcgccgcgaccgcgacg
gcgaccctcgccgagctgggcgtcggtaacgtggcggtgatgcaggggccgctgaacgcc
ggctgggccgccgaggcgccctacgacctcatcctgctcaacggggcggtggacgaggtg
ccggccaacctcttcgctcaggtgaaggagggcggccgagtcgtcgccgtggtcggccat
gggggcgccggacaggcccgcgtgttcaccaaggtggccggtgccatgagcgagcgggtg
gccttcaacgccgccgtgcccgcgctgcccggcttcaaggccgcgccacgcttcgttttc
tga

DBGET integrated database retrieval system