KEGG   Xanthobacter autotrophicus: Xaut_4252Help
Entry
Xaut_4252         CDS       T00581                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xau  Xanthobacter autotrophicus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xaut_4252
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Xaut_4252
   00630 Glyoxylate and dicarboxylate metabolism
    Xaut_4252
Enzymes [BR:xau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Xaut_4252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4717931..4720102
Genome map
AA seq 723 aa AA seqDB search
MASGTEARVERAGLQIARTLHDFIETEALPGSGIEADVFWEGLSAIAHDLAPRNRELLAR
REELQKTLDQWYRDNGTPLDLEAYKAFLTKIGYLVPEGPAFSVTTANVDPEIAEVAGPQL
VVPVMNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGYNPVRGAKVIAWGRAFLD
ESAPLKAGSWADAGPLSVKDGALAVGATGLADPSQFAGYRGEASAPSAVLLKKNGLHVEI
VVDRASVIGKDDTAGISDLVLEAALTTIQDCEDSVAAVDAEDKVAVYRNWLGLMSGDLKE
EIAKGGRIFTRSLNPDREYTAPDGCTLVLPGRSLMLVRNVGHLMTNPAILLKDGSEIPEG
IMDAAVTALIALRDIGPNGRRANSRAGSMYVVKPKMHGPEEVAFAVEIFDRVEDLLGLPS
DTIKMGIMDEERRTTVNLKESIRAASSRVAFINTGFLDRTGDEIHTSMEAGPMVRKGDMK
QAAWISAYEARNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHQVQAALRSRPKAKLDDLLTIPVAVRPNWTPEDIQHELDNNAQG
ILGYVVRWVDQGVGCSKVPDIHDVGLMEDRATLRISAQHMANWLRHGVCSEAQVLETLKR
MAAVVDRQNAGDPLYRPMAPDFTSIAFQAACDLVFKGREQPSGYTEPLLHQRRLELKAQS
AAA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgggaccgaggcccgggtggaacgcgccgggctgcaaatcgcgcgtactctg
cacgacttcattgaaaccgaggcattgcccggcagcggcatcgaggcggacgtcttctgg
gagggcctttccgccatcgcccacgacctggcaccgcgcaaccgcgaactcctggcgcgg
cgcgaggagctgcagaagaccctcgaccagtggtatcgcgacaatggcacccccctcgat
ctggaggcctacaaggccttcctgacaaagatcggctatctggtgcccgaaggccccgcc
ttcagcgtgaccacggccaatgtggaccccgagatcgccgaagtggccggcccgcagctg
gtcgtgccggtgatgaacgcgcgctacgcgctgaatgccgccaatgcgcgctggggctcg
ctctatgacgcgctctacggcaccgacgccatccccgagaccgacggcgccgagaagggc
aagggctacaatcccgtccgcggcgccaaggtcatcgcctggggccgcgcgttcctcgac
gagagcgcgcccctgaaggccggctcctgggccgatgccggtccgctgtcggtcaaggac
ggcgcccttgcggtcggcgccaccggccttgcggacccgtcccagttcgccggctatcgg
ggcgaggcctcggcgccgtccgccgtgctgctgaagaagaacggcctccatgtggagatc
gtggtggaccgcgccagcgtcatcggcaaggacgataccgccggcatctccgacctggtg
ctggaagccgccctcaccaccatccaggactgcgaggattccgtcgccgccgtggatgcg
gaggacaaggtcgcggtctaccgcaactggctcggcctgatgagcggcgacctcaaggag
gagatcgccaagggcgggcgcatcttcacccgcagcctgaatcccgaccgggaatatacc
gcgccggacggctgcaccctggtgctgccgggccgctcgctcatgctggtgcgcaacgtg
ggccacctcatgaccaatccggccatcctgctgaaggacggctcggaaatccccgagggc
atcatggatgccgccgtcaccgcgctcatcgccctgcgcgacatcggccccaacggacgc
cgcgccaacagccgcgccggctccatgtatgtggtcaagcccaagatgcacgggccggaa
gaggtggcgttcgcggtggagatcttcgaccgcgtcgaggatctgctgggcctgcccagc
gacaccatcaagatgggcatcatggacgaggagcgccgcaccacggtgaacctgaaggag
agcatccgcgccgcatccagccgggttgccttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacttccatggaagccggccccatggtccgcaagggcgacatgaag
caggctgcctggatcagcgcctacgaggcccgcaacgtggacatcggcctggagtgcggc
cttgccggccatgcccagatcggcaagggcatgtgggccatgccggacctgatggccgcc
atgcttgagcagaagatcgcccaccccaaggccggcgccaacaccgcctgggtgccgtcg
cccactgccgccaccctgcacgccacccactatcacaaggtggacgtgcatcaggtgcag
gccgcgctgcgcagccgcccgaaggccaagctggacgatctcctgaccatcccggtggcg
gtgcggccgaactggacgcccgaggacatccagcacgagctggacaacaatgcccagggc
atcctcggctatgtggtgcgctgggtcgaccagggcgtcggctgctccaaggtgccggac
atccacgacgtgggcctgatggaggatcgcgccaccctgcgcatctccgcccagcacatg
gctaactggctgcgccacggcgtgtgcagcgaggcgcaggtgctggagacactgaagcgc
atggcggcggtggtggaccggcagaatgccggcgatccgctctaccggcccatggcgccg
gacttcacctccatcgccttccaggccgcctgcgacctcgtcttcaagggccgcgagcag
ccgagcggctacaccgagccgctgctccaccagcgccggctggagctgaaggcgcagagc
gccgcggcctga

DBGET integrated database retrieval system