KEGG   Xanthobacter autotrophicus: Xaut_4295Help
Entry
Xaut_4295         CDS       T00581                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xau  Xanthobacter autotrophicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Xaut_4295
Enzymes [BR:xau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Xaut_4295
Exosome [BR:xau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Xaut_4295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4762551..4763633)
Genome map
AA seq 360 aa AA seqDB search
MNNERIMAFTTPRIRPVSEAELARTQGLDLQGLDLVHRPRRNRKTDWARRLVRENTLTVD
DLIWPIFVMNGTATRAPIPSMPGVERLTVDEAVRAAEMAAKLKIPAIAIFPYVDPSLRDP
LGSEALNSNNLVCQTLRAIKAEIPEIGLITDVALDPFTSHGHDGLLEDGRILNDETVEIL
VRQSVVQAQAGADVIAPSDMMDGRIGAIRAGLDAAGFTDVQIMSYAAKYASAFYGPFRDA
IGTAKTLSGDKRTYQMDPGNGLEAIREAALDVEEGADMLMVKPGLPYLDIVYRLKETFGL
PTFAYQVSGEYAMIEGAIRNGWVDGDRIVTESLLAFKRAGADGILTYFAPRVAERLAAQG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaacgagcgcatcatggccttcaccacgccccgcatccgtcccgtttccgaagcc
gagctggcccggacccagggtctcgacctccaaggcctcgacctggtccaccgcccccgg
cgcaaccgcaagaccgactgggcgcggcggctggtgcgtgagaacaccctcaccgtggac
gacctgatctggccgatcttcgtgatgaacggcaccgccacccgcgcccccatcccctcc
atgccgggggtggagcgcctgaccgtggacgaggcggtccgcgcggccgagatggccgcc
aagctgaagatccccgcgatcgccatcttcccctatgtggacccgagcctgcgcgatccc
ctgggcagcgaggcgctgaacagcaacaacctggtttgccagaccctgcgcgccatcaag
gcggagatccccgagatcgggctgatcaccgacgtggcgctggaccctttcaccagccac
ggccatgacggcctgctggaggacgggcgcatcctcaatgacgagaccgtggaaatcctg
gtgcggcagtcggtggtgcaggcgcaggcgggggcggacgtgatcgcaccctccgacatg
atggacggccgcatcggcgccatccgcgccgggctggacgcggcgggcttcaccgatgtg
cagatcatgtcctacgctgccaagtatgcgtccgccttctacggcccgttccgcgacgcc
atcggcaccgccaagaccctttccggcgacaagcgcacctaccagatggaccccggcaac
ggcctggaagccatccgcgaggccgccctcgacgtggaggaaggcgccgacatgctcatg
gtgaagccgggcctgccctatctcgacatcgtctaccgcctcaaggagaccttcggcctg
cccaccttcgcctatcaggtgtccggcgagtacgcgatgatcgagggcgccatccgcaac
ggctgggtggacggtgaccgcatcgtcaccgagagcctgctcgccttcaagcgcgccggc
gccgacggcatcctgacctatttcgcgccgcgcgttgccgagcggctggccgcgcagggc
tag

DBGET integrated database retrieval system