KEGG   Xanthobacter autotrophicus: Xaut_4380Help
Entry
Xaut_4380         CDS       T00581                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xau  Xanthobacter autotrophicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xaut_4380
   01230 Biosynthesis of amino acids
    Xaut_4380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xaut_4380
   00051 Fructose and mannose metabolism
    Xaut_4380
   00562 Inositol phosphate metabolism
    Xaut_4380
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Xaut_4380
Enzymes [BR:xau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Xaut_4380
Exosome [BR:xau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Xaut_4380
  Exosomal proteins of bladder cancer cells
   Xaut_4380
  Exosomal proteins of melanoma cells
   Xaut_4380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4856997..4857761
Genome map
AA seq 254 aa AA seqDB search
MPASRRVLIAGNWKMNGLKSSLAEIEALAAGYDGDLKAKLDLLVCPPATLLISAAERLAG
SGVQLGGQNCHPAPAGAHTGGISAEMLKDAGVTSVIVGHSERRTNLSESDAVVMAKVKAA
WCFGLLPIVCVGETAEERDAGEAVGVVTRQVHQSLPEGCTASNLVIAYEPVWAIGTGRTP
TPEDVANIHGTIRSVLRSQFGAEADGIRILYGGSVKPDNAATLMAVADVDGALVGGASLK
AADFLAIARATPAR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcttcccgccgcgtcctgatcgccggcaactggaaaatgaacgggctgaagagc
tccctcgccgagatcgaggccctggccgcgggctatgatggcgacctcaaggccaagctg
gacctgctggtctgcccgcccgcaacgctcctgatctccgccgccgagcgcctcgccggc
tccggggtgcagctgggcggccagaattgccatccggcccccgcgggcgcccacaccggc
ggcatttccgccgagatgctgaaggatgccggcgtcacgtcggtcatcgtcggccattcc
gagcgtcgcaccaacctgtcggagagcgatgcggtggtgatggccaaggtgaaggcggcg
tggtgcttcgggttgctgcccatcgtctgcgtcggcgagaccgccgaggagcgcgatgcc
ggcgaggccgtgggggtggtgacgcgccaggtgcaccagtcgctgccggaaggctgcacc
gcatccaacctggtcatcgcctacgagccggtctgggccatcggcaccggccgcacgccc
acccctgaggacgtggccaacatccatggcaccatccgctccgtgctccgctcacagttc
ggcgccgaggctgacggtattcgcatcctctacggcggctcggtgaagccagacaatgcg
gcgaccctgatggccgttgccgatgtggacggcgcactggtgggaggcgccagcctgaag
gcagcggatttcctcgccatcgcccgggccaccccggcgcggtga

DBGET integrated database retrieval system