KEGG   Xanthobacter autotrophicus: Xaut_4380Help
Entry
Xaut_4380         CDS       T00581                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00010  Glycolysis / Gluconeogenesis
xau00051  Fructose and mannose metabolism
xau00562  Inositol phosphate metabolism
xau00710  Carbon fixation in photosynthetic organisms
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01200  Carbon metabolism
xau01230  Biosynthesis of amino acids
Module
xau_M00002  Glycolysis, core module involving three-carbon compounds
xau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xaut_4380
   00051 Fructose and mannose metabolism
    Xaut_4380
   00562 Inositol phosphate metabolism
    Xaut_4380
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Xaut_4380
Enzymes [BR:xau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Xaut_4380
Exosome [BR:xau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Xaut_4380
  Exosomal proteins of bladder cancer cells
   Xaut_4380
  Exosomal proteins of melanoma cells
   Xaut_4380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS69601
JGI: Xaut4380
UniProt: A7INK7
Position
4856997..4857761
Genome map
AA seq 254 aa AA seqDB search
MPASRRVLIAGNWKMNGLKSSLAEIEALAAGYDGDLKAKLDLLVCPPATLLISAAERLAG
SGVQLGGQNCHPAPAGAHTGGISAEMLKDAGVTSVIVGHSERRTNLSESDAVVMAKVKAA
WCFGLLPIVCVGETAEERDAGEAVGVVTRQVHQSLPEGCTASNLVIAYEPVWAIGTGRTP
TPEDVANIHGTIRSVLRSQFGAEADGIRILYGGSVKPDNAATLMAVADVDGALVGGASLK
AADFLAIARATPAR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcttcccgccgcgtcctgatcgccggcaactggaaaatgaacgggctgaagagc
tccctcgccgagatcgaggccctggccgcgggctatgatggcgacctcaaggccaagctg
gacctgctggtctgcccgcccgcaacgctcctgatctccgccgccgagcgcctcgccggc
tccggggtgcagctgggcggccagaattgccatccggcccccgcgggcgcccacaccggc
ggcatttccgccgagatgctgaaggatgccggcgtcacgtcggtcatcgtcggccattcc
gagcgtcgcaccaacctgtcggagagcgatgcggtggtgatggccaaggtgaaggcggcg
tggtgcttcgggttgctgcccatcgtctgcgtcggcgagaccgccgaggagcgcgatgcc
ggcgaggccgtgggggtggtgacgcgccaggtgcaccagtcgctgccggaaggctgcacc
gcatccaacctggtcatcgcctacgagccggtctgggccatcggcaccggccgcacgccc
acccctgaggacgtggccaacatccatggcaccatccgctccgtgctccgctcacagttc
ggcgccgaggctgacggtattcgcatcctctacggcggctcggtgaagccagacaatgcg
gcgaccctgatggccgttgccgatgtggacggcgcactggtgggaggcgccagcctgaag
gcagcggatttcctcgccatcgcccgggccaccccggcgcggtga

DBGET integrated database retrieval system