KEGG   Xanthobacter autotrophicus: Xaut_4690Help
Entry
Xaut_4690         CDS       T00581                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
xau  Xanthobacter autotrophicus
Brite
Enzymes [BR:xau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Xaut_4690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5197749..5200748)
Genome map
AA seq 999 aa AA seqDB search
MTSFYERPILNSPYCVPGLHHPLDKNGQPIDGEPRQGRRPSRHIVPVPASRKKASAGQAS
LDLETYSDYPLINEIRSFVDTWRALPNPADWGVTGTTQRLLEHWRHGQFSGPQPFFCQVE
AAETIIWLTEVAPKRTATRRLRDELEQHNKGANPALFRLAMKMATGSGKTTVMAMLIAWQ
AVNAARKATKDFSRAFLIIAPGITIRDRLRVLLPSEPDNYYETREIVPPEMLPDIRRAEI
VITNYHAFQHRETLALPKVARSFLQGNAPEPLKTTETDAEMLERACGKLLNYDRVTVIND
EAHHCYRHKVGGDAEGPLTGEDKKEAAENEEAARLWINGIEALDRRLSKGVRAVYDLSAT
PFFLRGSGYQEGYLFPWVVSDFSLMDAIESGIVKLPRVPVTDNLVQTDRVVYRDLWKSIG
KSLPKTAAGAAKISPFDLPPTLLTALTALYSHYEGEFKRWERAGIGVPPVFIVVCQNTAI
SKLVFEWIAGFERGDANEGERAAFHAGHLELFRNYDEHGARLPRPRTLLIDSREIESGKA
LDKGFRDAAGPEIEQFKRELASREGAGSVNGDVSEGELLREVMNTVGRPGRLGEQIRCVV
SVSMLTEGWDTNTVTHILGVRAFGTQLLCEQVVGRALRRQSYDLNREIGLFDVEYADIIG
IPFDFAASPQKAEPVKPKPVTRVHAIKERAGLEIAFPRVSGYRRELPSEKLEAVFSDDSR
LEITPLDIGPTAVVMEGIVGAGVTITPEVLDRLRPSEISFNLAKHLLYSHFRDEEGFPKQ
HLFPQIQRLARRWIDEGYLVTKGVPIGAILYQDQLARAAEKIDIALTRGSEGQIMAVLDP
YNPKGSTRHVNFITSKPCWKTGAQPPKCQISHVVLDSSWEEQLALTLETHPRVIAYAKNQ
ALGFEIPYLDGGTMRRYVPDFLVRLDDGGTTPLHLVLEVKGLRDEADKAKAQTTRDLWVP
GVNALGGFGRWDFAEFRDWTTMTEDFAALVERLLKKVAA
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagcttttacgagcggccgattctgaactcgccatattgcgtgccgggattgcac
catccactcgacaagaatggccagccgatcgacggcgagccgaggcaaggccgccgcccc
tcccggcacatcgtgcccgtcccggcatcgcggaagaaagcgtcggccggtcaggcctcg
ctcgatctggaaacctacagcgactacccccttatcaacgagattcgtagtttcgtcgac
acatggcgcgcgctgcccaaccctgccgactggggggtgacagggacgacgcagcggctt
ctggaacactggcggcatgggcagttttcaggcccgcagccgttcttctgccaggttgaa
gcggccgaaaccatcatctggctgaccgaggtcgccccgaaacgcaccgccaccaggcgc
ctgcgcgacgaactggaacagcacaataagggagccaatcccgcgctctttcgtcttgcc
atgaagatggcgaccggcagcggcaagaccaccgtcatggccatgctgatcgcctggcag
gcggtgaatgctgcgcgcaaggcaacgaaggatttctcgcgcgccttcctgattatcgcc
ccgggcatcaccatccgtgaccgcctgcgtgtgctgcttcccagcgagccggacaattat
tacgagacgcgcgagatcgtgccgccggagatgctgccggatatccggcgcgcggaaatc
gtcattaccaactaccacgcgttccagcaccgcgagacgctggccttgcccaaggtcgcc
cgcagcttcctgcagggcaacgctccggagccgttaaaaaccacggaaaccgacgccgag
atgctcgaaagagcatgcggcaagctgctcaattacgatcgcgtcacggtcatcaacgac
gaggcgcaccattgctaccgccacaaggtgggcggcgacgccgaaggtccgctcacgggc
gaggacaagaaggaggcggccgagaacgaagaggcggcgcggctctggatcaacggcatc
gaggcgctcgaccgcaggctttcgaagggggtgcgcgcggtctatgacctctccgccacg
cctttcttcctgcgcggctcgggctatcaggaggggtatctcttcccctgggtggtgtcc
gatttcagcctgatggatgccatcgagagtggcatcgtcaagctgccccgcgtgcctgtg
accgacaatctcgtgcagaccgatagggtggtctaccgcgacttgtggaagtcgatcggc
aaatcgctgccgaagaccgccgccggcgccgccaagatcagcccgttcgatctgcccccg
acgctgctgaccgcgctgaccgcgctctacagccattacgagggcgagttcaagcggtgg
gagcgggccgggatcggggtgccgccggtgttcatcgtggtgtgccagaacacggccatt
tccaagctggtgttcgaatggatcgccggcttcgagcgcggcgatgccaatgagggcgag
cgcgcggcctttcatgcgggccacctcgagctgttccgcaattatgacgaacacggcgcc
cgccttccccgcccgcgcacgctcctgatcgattcccgcgagatcgaatccggcaaggcg
ctggacaaggggttccgcgacgccgccggcccggagatcgagcagttcaagcgcgagctg
gccagccgcgagggcgccggcagcgtgaacggcgacgtgagcgagggcgagctgctgcgc
gaggtgatgaacaccgtgggccgccccggccgcctcggcgagcagatccgctgcgtggtc
tcggtgtccatgctgaccgaggggtgggacaccaacaccgtcacccacatcctcggggtg
cgcgccttcggcacccagctcctgtgcgagcaggtggtgggccgtgccctgcgccggcaa
tcctatgacctgaaccgcgagatcggcctgttcgacgtggaatatgccgacatcattggc
attccgttcgatttcgccgcctcgccgcagaaggccgagccggtgaagccgaagccggtc
acgcgcgtccatgccatcaaggagcgggcggggctggagatcgcctttccccgtgtcagc
ggctatcggcgggagctgccttcggaaaagctggaggcggtgttctccgacgacagccgg
ctggagatcacgccgctggacatcggccccacggcggtggtcatggagggcatcgtcggc
gccggcgtcaccatcacgcccgaggtgctggaccggctgcggccgtccgagatcagcttc
aacctcgccaagcacctgctctattcgcatttccgcgacgaggagggctttcccaagcag
cacctgttcccgcagatccagcgtcttgcgcgccgctggatcgacgagggctatctggtg
acgaagggcgtgcccatcggcgccatcctctatcaggaccagctggcccgcgcggcggag
aagatcgacattgccctcactcgcggcagcgaggggcagatcatggcggtgcttgatccc
tacaatccgaaggggtccacccgccacgtcaacttcatcacctcgaagccctgctggaag
accggcgcgcagccgcccaagtgccagatcagccatgtggtgctggattccagctgggag
gaacagctggccctcacgctggagactcatccgcgtgtgatcgcctatgccaagaaccag
gcgctgggcttcgagatcccctatctcgatggcggcaccatgcggcgctatgtgcccgat
ttcctcgtgcggctggatgacggcggcaccacgccgctccatctggtgctggaggtgaag
ggcctgcgcgacgaggccgacaaggccaaggcgcagacgacccgcgacctgtgggtgccc
ggcgtcaacgccctcggcggcttcggccgctgggacttcgccgaattccgtgactggacg
accatgaccgaagacttcgccgcgctggttgaacgactgctcaagaaggttgccgcctga

DBGET integrated database retrieval system