KEGG   Xanthobacter autotrophicus: Xaut_5055Help
Entry
Xaut_5055         CDS       T00581                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
xau  Xanthobacter autotrophicus
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:xau00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pXAUT01:276085..277080
Genome map
AA seq 331 aa AA seqDB search
MEQPDMRLMEPPRLVLNPTVTPLLPAPQLTGTLGGPEIWIKRDDLIPFGCGGNKIRGLEL
IVADALRAGADTLVTGAGTLSNHVRATAAAAAFAGLGMSAVYWGDPPQKAKGNHLLSVLW
GARTRFTGSSDRNSVDAMLEVEAADIRAAGGRPYVIPRGGACALGVIGHVHAVGEVMAQC
RQAGIRPDCVVMAVGSGGTLAGWLLGSRLLGASWRVEGITVSRPAAEARVRVKDLADQAA
DHLGLARSVAADDVVIHDGFIGAGYGIASPAGMSAIERAARSEGVVLDPVYTGKAMAGYG
ALLGAGRYGDATTVLFLHSGGLPSLFVDGNA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcctgacatgcggctcatggagccgccgcgtctcgtcctcaaccccaccgtc
acgccgctgctgcccgcgccgcagctgaccggcacgctgggcggccccgagatctggatc
aagcgcgacgacctgatcccgttcgggtgcggcggcaacaagatccgcggcctggagctc
atcgtcgccgatgcgctgagagcgggcgccgacaccttggtgaccggcgccggcacgctc
tccaaccacgtgcgggcgacggcggcggcggcggccttcgccggcctcggcatgagcgcc
gtctattggggcgatccaccccagaaggcgaagggcaatcacctcctctcggtgctgtgg
ggcgcgcggacccgcttcaccggatcgagcgaccgcaattccgtcgacgcgatgctggag
gtggaggccgccgacatccgggccgcgggcgggcggccttatgtgatcccgcggggtggg
gcgtgcgcgcttggcgtgatcggccacgtccatgcggtgggcgaggtcatggcgcagtgc
cgccaggcgggcatccggcccgattgcgtggtgatggcggtcggctccgggggcaccttg
gcgggctggctcctgggctcgcggctcttgggcgcctcctggcgggtggaaggcatcacg
gtgagccggccggccgccgaggcccgcgtccgcgtcaaggatctcgccgatcaggcggcc
gatcatctgggccttgcccgctccgtcgcggccgacgacgtggtcatccacgacggcttc
atcggcgcgggttacggcatcgcctcgcccgcgggcatgtccgcgatcgaacgcgcggcg
cgctcagagggcgtggtgctggaccccgtctatacgggcaaggccatggccggctatggc
gcgctgctcggcgcggggcgctatggcgatgccaccaccgttctgttcctgcacagcggc
gggctgccaagcctgttcgtcgatggaaatgcgtga

DBGET integrated database retrieval system