KEGG   Xanthomonas alfalfae: XACM_0030Help
Entry
XACM_0030         CDS       T01616                                 

Gene name
egl1
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xax  Xanthomonas alfalfae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XACM_0030 (egl1)
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XACM_0030 (egl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31391..32524)
Genome map
AA seq 377 aa AA seqDB search
MSAVCFSLRALLRSTLLFIVFGSLSLAHAQTRALTYAGVNLSGAEYASSKKPGVLNKDYM
YPATNDYTYFAGVGMNTIRLPILWERLQPSANGELDPAQLALLQQAVARAKAAGMYLLID
IHNYAKYYGYKIGGPEVPVATFTDLWRRLALAFNSDNAVMFGLMNEPNNISASEWAGAAQ
AAIDAIRRTGANNLILVPGALWTGAHSWYSPTSDGYSNATALTAIYDPLNRYAFEVHQYL
DADSSGTSSTCVSSTIGAERLRNFTQWLRTNRKRGFLGEFGTANNAVCNQALQGMLAHME
TNADVWLGWTWWAAGSWWNLSYAYNVHPNKDGTDKPQMAILSPQAALATRAPVATAAARS
SAASTSATSTSAARTTR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgtctgcttttcgttgcgcgcgctactgcgctctacgctgcttttcatcgtg
ttcggtagcctgtcgctggcccacgcgcagacgcgcgcgctcacctatgccggcgtcaat
ctttcaggtgccgagtacgcatcgtccaagaagcccggagtcctcaacaaggactatatg
taccccgcgaccaacgattacacctatttcgccggtgtcggcatgaataccatccgcctg
cccatcctgtgggagcggctgcagcccagcgcgaacggcgaactggacccggcacagctc
gcgttgctgcagcaggcggtggcacgcgccaaggcagccggtatgtatctgctcatcgat
atccacaactacgccaagtattacggctacaagatcggcggcccggaagtaccggtggcc
acgtttaccgatctctggcgtcgtctggcgctggcgttcaacagcgacaacgcggtgatg
ttcgggctgatgaatgagcccaacaatatttcggccagcgaatgggccggcgcagcgcag
gccgccatcgatgccatccgcaggaccggtgccaataacctgattctggtgcccggcgca
ttgtggaccggcgcgcacagttggtattcccccacgagcgatggctattccaacgccacc
gcgctgaccgccatctacgacccgctcaatcgctacgccttcgaagtgcaccagtatctg
gatgccgattccagcggcaccagcagcacctgtgtcagcagcaccatcggcgccgagcgc
ctgcgcaacttcacgcagtggctgcgcaccaaccgcaagcgcggctttctgggcgaattc
ggcaccgccaacaatgcggtgtgcaaccaggcgctgcaaggcatgttggcacacatggaa
accaatgcagacgtgtggctgggctggacctggtgggcggccggttcgtggtggaacctc
agctacgcgtacaacgtgcaccccaacaaggacggcaccgacaagccgcagatggcgatc
ctgtcgccacaggccgcactcgccacgcgtgcgccggttgcgactgccgcagcgcggagc
tccgctgcatcgacctcggcaacaagcacatccgctgcacgcacgacacgctga

DBGET integrated database retrieval system