KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0030Help
Entry
XACM_0030         CDS       T01616                                 

Gene name
egl1
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xax00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31391..32524)
Genome map
AA seq 377 aa AA seqDB search
MSAVCFSLRALLRSTLLFIVFGSLSLAHAQTRALTYAGVNLSGAEYASSKKPGVLNKDYM
YPATNDYTYFAGVGMNTIRLPILWERLQPSANGELDPAQLALLQQAVARAKAAGMYLLID
IHNYAKYYGYKIGGPEVPVATFTDLWRRLALAFNSDNAVMFGLMNEPNNISASEWAGAAQ
AAIDAIRRTGANNLILVPGALWTGAHSWYSPTSDGYSNATALTAIYDPLNRYAFEVHQYL
DADSSGTSSTCVSSTIGAERLRNFTQWLRTNRKRGFLGEFGTANNAVCNQALQGMLAHME
TNADVWLGWTWWAAGSWWNLSYAYNVHPNKDGTDKPQMAILSPQAALATRAPVATAAARS
SAASTSATSTSAARTTR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgtctgcttttcgttgcgcgcgctactgcgctctacgctgcttttcatcgtg
ttcggtagcctgtcgctggcccacgcgcagacgcgcgcgctcacctatgccggcgtcaat
ctttcaggtgccgagtacgcatcgtccaagaagcccggagtcctcaacaaggactatatg
taccccgcgaccaacgattacacctatttcgccggtgtcggcatgaataccatccgcctg
cccatcctgtgggagcggctgcagcccagcgcgaacggcgaactggacccggcacagctc
gcgttgctgcagcaggcggtggcacgcgccaaggcagccggtatgtatctgctcatcgat
atccacaactacgccaagtattacggctacaagatcggcggcccggaagtaccggtggcc
acgtttaccgatctctggcgtcgtctggcgctggcgttcaacagcgacaacgcggtgatg
ttcgggctgatgaatgagcccaacaatatttcggccagcgaatgggccggcgcagcgcag
gccgccatcgatgccatccgcaggaccggtgccaataacctgattctggtgcccggcgca
ttgtggaccggcgcgcacagttggtattcccccacgagcgatggctattccaacgccacc
gcgctgaccgccatctacgacccgctcaatcgctacgccttcgaagtgcaccagtatctg
gatgccgattccagcggcaccagcagcacctgtgtcagcagcaccatcggcgccgagcgc
ctgcgcaacttcacgcagtggctgcgcaccaaccgcaagcgcggctttctgggcgaattc
ggcaccgccaacaatgcggtgtgcaaccaggcgctgcaaggcatgttggcacacatggaa
accaatgcagacgtgtggctgggctggacctggtgggcggccggttcgtggtggaacctc
agctacgcgtacaacgtgcaccccaacaaggacggcaccgacaagccgcagatggcgatc
ctgtcgccacaggccgcactcgccacgcgtgcgccggttgcgactgccgcagcgcggagc
tccgctgcatcgacctcggcaacaagcacatccgctgcacgcacgacacgctga

DBGET integrated database retrieval system