KEGG   Xanthomonas alfalfae: XACM_0141Help
Entry
XACM_0141         CDS       T01616                                 

Gene name
glgB1
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xax  Xanthomonas alfalfae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XACM_0141 (glgB1)
Enzymes [BR:xax01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XACM_0141 (glgB1)
Exosome [BR:xax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XACM_0141 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165294..167468
Genome map
AA seq 724 aa AA seqDB search
MSNRWDPGAVRALAEARHGDAFAVLGAHPSDNGRLLRTYLPGADRVSAVLDDGQVVALDA
GPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAFGPQLSDFDLHLISEGHHLQLADAL
GANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQAGVWELFVPDVGPG
AHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHD
APMSIYEIHAGSWLREAGLDLDWDGLADRLIPYVADMGFTHVELMPVSEHPFGGSWGYQP
LGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEHADP
REGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRDYSRNAGEW
IPNIHGGRENYETIAFLRRLNEVVREHTPGAVMIAEESTAFPGVTADVAHGGLGFHYKWN
MGWMHDTLHYAGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRMPGD
DWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDPRHRGVQTLVR
DLNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVINFTPVVQH
GYRIGVPQGGQWREVFNSDAGIYGGSNLGNGGSVTAEQQSMHGHAQSLPLLLPPLGAIVL
TPYG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatcgatgggatcccggcgcggtacgcgccctggcagaggcgcgccatggcgac
gcgttcgcggtattgggcgcacacccgtccgacaacgggcgcttgttgcgcacctatcta
cccggcgccgaccgggtcagcgcggtgctcgacgatgggcaggtggtggcgctggacgcc
ggcccggagccgggcctgttcgccggcgagttgccggcgcacggtgggtatcgcctgcgc
atcggctggcccggtggcgagcaggagaccgccgacccgtacgcgttcggcccgcagctc
agtgacttcgacctgcacctgatcagcgaaggccaccacttgcaattggccgacgcgctg
ggcgccaacgtggtcgaagtggacggcgtgcgcggcacgcgctttgccgtctgggcaccg
aatgcctcgcgcgtggcggtggtgggcgacttcaacagctgggacgcgcgccggcatccg
atgcggctgcgtcaccaggccggcgtgtgggagttgttcgtgcccgacgtcggccccggc
gcgcattacaagtaccagctgcgcggtccgcacgggcacgaactgccggccaaggccgac
ccggtggcacgccgcgcggagcttgcgccgggcactgcgtccatcgtggccgaccccacg
ccgcatcagtggagcgacgacggctggatggccacgcgtgcgcgccgccaggcccatgac
gcgccgatgagcatctacgagatccatgccggctcgtggttgcgcgaagcaggcctggat
ctggattgggacgggctggccgatcgcctgattccgtacgtggccgatatgggctttacc
catgtcgagttgatgccggtgagcgagcatccgttcggcggctcctggggctaccagcca
ttgggtctgttcgcgccgaccgcgcgtttcgggacacccgatggatttgcgcgctttgtc
gaccgctgccaccgcgaaggcatcggcgtaatcgtcgattgggtgccggcgcactttccc
accgatgcgcacgggctggcgcatttcgacggcaccgcgctgtacgagcatgccgaccca
cgcgaaggcttccaccgcgactggaatacgctgatctacaaccacggccgccgcgaggtg
tccgggttcctgattgccagtgcgatggaattcctgcagcgctatcacgtcgatggcctg
cgcgtggatgcggtggcctcgatgctgtatcgcgattacagccgcaacgccggcgagtgg
atacccaacatccacggcgggcgcgagaactacgagaccatcgcgttcctgcgccggctc
aacgaggtggtgcgcgagcacacacccggcgcggtgatgattgccgaggaatccactgcg
tttcccggtgtcaccgccgacgtggcgcacggcggcctgggctttcactacaaatggaac
atgggctggatgcacgacaccctgcattacgccgggctggatccgatctatcgccgctac
caccacggtgagctgactttcagcatggtctatgcgtattcggagcgcttcgtgctgccg
atctcgcacgacgaagtggtgcacggcaagggttcgttgctgggccgcatgccgggcgac
gattggcagcgcttcgcgaatctgcgtgcttacctgggtttcatgttcacccacccgggg
cgcaagttgctgttcatgggctgcgaattcggtcaaccgaccgagtggaaccacgacgcc
ggccttccgtggcatttgctcgacgaccctcgccatcgtggtgtgcagacgttggtgcgc
gatttgaaccggctgtatgtgcaatacccggcgctgcatgcgcacgacgacgatccgtcc
ggattcgcctgggtggtgggcgacgatgccggcaatagcgtggtggcgttcctgcgcaag
ggcaaacgtggcgacgcaccggtgctggtggtgatcaacttcactccggtcgtgcagcac
ggctatcgcatcggcgtgccacaaggcggccagtggcgtgaggtgttcaacagcgacgcc
ggcatctacggcggcagcaacctgggcaatggcggcagcgtgacggccgagcagcaatcc
atgcatgggcacgcgcaatcgctgccgctgctgttgccaccgctgggcgccatcgtgctg
acgccgtatggctga

DBGET integrated database retrieval system