KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0165Help
Entry
XACM_0165         CDS       T01616                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax01040  Biosynthesis of unsaturated fatty acids
xax01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XACM_0165
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XACM_0165
Lipid biosynthesis proteins [BR:xax01004]
 Desaturase
  First
   XACM_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 TraL
Motif
Other DBs
NCBI-ProteinID: AEO40475
UniProt: G2LYU5
Position
193560..194777
Genome map
AA seq 405 aa AA seqDB search
MEMPMLSDPIIDVLTSGVAGLGVWGMLAVLLVFTQLTIFAVTLYLHRSQAHRGVDFHPAI
AHFFRFWTWLTTSMITREWVAIHRKHHAKVETEEDPHSPQTKGIGQVFWRGVELYRQARA
ERADIEQYGKGAPSDWIERHLYTPHANAGPMALLVINSVLFGLPGIALWAIQMAWIPFWA
AGVVNGLGHWWGYRNFESADTSTNLTPWALWIGGEELHNNHHAFPSSARFSMRRWELDIG
WVAIRGLQALGLAKVLRVAPSLDIRPNIAVPDADTLKALLSHRFQAMTDYQRNVLKPALR
EEAAVTGARLRELLPRRLRKGLVDDGRWLKPDARAQLQAWVAQRPRMRTLVEYRARLTAV
LEARSHDASERLRQLQQWCHEAEASGNAALQAYAARLKGYALSGA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggagatgccgatgttgtccgatccgatcatcgacgttctgacttccggcgtggcaggg
ctgggcgtgtggggcatgctggcggtgctgctagtcttcacccagctcaccatctttgca
gtgaccttgtacctgcatcgcagccaggcgcatcgcggtgtggatttccatccggccatc
gcgcatttcttccgcttctggacctggttgaccacctcgatgatcacccgcgaatgggtg
gcgatccatcgcaagcatcacgccaaggtcgagaccgaggaagacccgcacagcccgcag
accaagggcatcggccaggttttctggcgcggtgtggagctgtatcggcaggcgcgtgcc
gagcgtgccgacatcgagcaatacggcaagggcgcgcccagcgactggatcgaacggcat
ctgtacacgccgcatgccaacgccggcccgatggcgttgctggtgatcaactcggtgttg
ttcggattgccgggaattgcgttgtgggcaatccagatggcgtggattccgttctgggcc
gccggtgtggtcaacggcctgggccactggtggggctatcgcaatttcgaatcggccgac
acctccaccaacctcacgccctgggcgctgtggatcggtggcgaagaattgcataacaac
catcatgccttcccgagctcggcgcggttttcgatgcggcgttgggagctggatatcggt
tgggtcgccattcgcggcttgcaggcactgggccttgccaaggtgttgcgggtggcgccg
tcgctggatatccgccccaatatcgccgtgcccgatgccgacacgctcaaggcgctgctc
tcgcaccggttccaggccatgaccgactaccagcgcaatgtgctcaagccggcgttgcgc
gaagaggcggccgtcaccggcgccaggctgcgcgagttgctgccgcgtcgcctgcgcaag
ggcctggtcgacgacgggcgctggctcaagccggacgcgcgtgcacagttgcaggcatgg
gtggcgcagcgtccgcgcatgcgcacgctggtcgagtaccgtgcgcggctgaccgcggta
ctggaagcgcgcagccacgatgcgtccgaacggctccggcaattgcagcagtggtgccat
gaggccgaggccagcggcaatgccgcgttgcaggcgtatgcggcgcggctcaaggggtat
gcgctgagtggtgcgtaa

DBGET integrated database retrieval system