KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0242Help
Entry
XACM_0242         CDS       T01616                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:xax01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:xax00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:xax00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275435..277051
Genome map
AA seq 538 aa AA seqDB search
MAATAFAPRPTDHATPGIALTTQIAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRRQR
QAAFDAGQLPDFRTDTQAIRAGDWRVAPLPAALLDRRVEITGPTDPKMVINALNSGAKVF
MADFEDSTAPTWRNLLAGQRTLAAAVRGDLSFDAPNGKHYALRPEAERAVLIVRPRGWHL
DEKHVLIDGQPLAGGLFDAALFAFHNGRALLAKDRGPYLYLPKLQSMEEAALWDTALAHI
EAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRERIVGLNCGRWDYIFSYLKTFRAHRD
RVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARVRA
DKLREVTAGHDGTWVAHPALIPVAMKLFDEHMPTAHQQHVVRNDVQVTRDMLIAPSPGNV
TRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRAQLWQWLHHGQHLDDGTA
IDQHLLQATLRALPARLGTATALPGAARIDEAIALLEELSRADELADFLTVPAYRLID
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaccgcgtttgctccccgtcccaccgaccacgccacgcccggtattgcgctg
accacccagatcgccggccaggcagagctgctgccggccgccgcgctggccctgctggtt
tcgctgcaccgggcgatcgagcccggccgccagcagcgtctggcccagcggcgccagcgc
caggccgctttcgatgccggtcagctgccagacttccgtaccgatacccaggccatccgt
gccggcgattggcgtgtggctcccctgccggcggcactgctggaccgccgtgtcgaaatc
accggcccgaccgacccgaagatggtcatcaatgcgctgaactccggcgccaaggtgttc
atggccgacttcgaagattccaccgcgccgacctggcgcaacctgctggccggccagcgc
accctggctgcggcggtgcgcggtgacctcagcttcgatgcgcccaacggcaagcactac
gccctgcgcccggaggccgaacgtgcagtgctgatcgtgcgcccgcgcggctggcacctg
gacgaaaagcacgtgttgatcgacggccagccgttggccggcggcctgttcgatgcggcg
ctatttgccttccacaatggccgagcgttgttggccaaggaccgcggcccgtacctgtac
ctgcccaagctgcagagcatggaagaagccgcactgtgggacaccgcgctggcgcatatc
gaagcgatgctgggcctgccgcatgggcagatcaaggtcaccgtgctgatcgaaacgctg
ccggcggtgttcgagatggacgaaattctccatgcgctgcgcgagcgcatcgtgggcctg
aactgcgggcgttgggactatatcttttcctacctgaaaacctttcgggcgcaccgcgac
cgcgtgctgcccgaacgcggccaggtcaccatgacccagccatttttgaaggcctattcg
gagctgttgatcaagacctgccatcgccgcggtgcgcatgcgatgggcggcatggccgcg
cagattccgatcaatcacgatgaagccgccaacgaacaggccatggcccgcgtgcgtgcc
gacaagttgcgcgaagtgaccgccggccacgatggcacctgggtggcgcatccggcgctg
attccggtggcgatgaaactgttcgacgaacacatgcccaccgcgcatcagcagcatgta
gtgcgcaatgacgtgcaggtgacgcgcgacatgttgatcgcgccctcgccgggcaatgtc
acccgcgccgggttcgaaggcaatgtcgaagtgtgcgtgcgctatctggcggcctggctg
gacggcaatggctgcgtgccgatccaccacctgatggaagacgccgccacggccgaaatc
agccgcgcgcagctgtggcagtggttgcatcacggccagcacctggatgatggcaccgcc
atcgatcaacacttgctgcaggccaccttgcgcgcactgcctgcacggctgggaaccgcc
accgcgctgcccggcgctgcacggatcgatgaagcgatcgccttactcgaagagttgagc
cgcgccgacgaactggcggacttccttaccgtaccggcgtaccgcctgatcgattga

DBGET integrated database retrieval system