KEGG   Xanthomonas alfalfae: XACM_0242Help
Entry
XACM_0242         CDS       T01616                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
xax  Xanthomonas alfalfae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XACM_0242
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XACM_0242
   00630 Glyoxylate and dicarboxylate metabolism
    XACM_0242
Enzymes [BR:xax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XACM_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275435..277051
Genome map
AA seq 538 aa AA seqDB search
MAATAFAPRPTDHATPGIALTTQIAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRRQR
QAAFDAGQLPDFRTDTQAIRAGDWRVAPLPAALLDRRVEITGPTDPKMVINALNSGAKVF
MADFEDSTAPTWRNLLAGQRTLAAAVRGDLSFDAPNGKHYALRPEAERAVLIVRPRGWHL
DEKHVLIDGQPLAGGLFDAALFAFHNGRALLAKDRGPYLYLPKLQSMEEAALWDTALAHI
EAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRERIVGLNCGRWDYIFSYLKTFRAHRD
RVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARVRA
DKLREVTAGHDGTWVAHPALIPVAMKLFDEHMPTAHQQHVVRNDVQVTRDMLIAPSPGNV
TRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRAQLWQWLHHGQHLDDGTA
IDQHLLQATLRALPARLGTATALPGAARIDEAIALLEELSRADELADFLTVPAYRLID
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaccgcgtttgctccccgtcccaccgaccacgccacgcccggtattgcgctg
accacccagatcgccggccaggcagagctgctgccggccgccgcgctggccctgctggtt
tcgctgcaccgggcgatcgagcccggccgccagcagcgtctggcccagcggcgccagcgc
caggccgctttcgatgccggtcagctgccagacttccgtaccgatacccaggccatccgt
gccggcgattggcgtgtggctcccctgccggcggcactgctggaccgccgtgtcgaaatc
accggcccgaccgacccgaagatggtcatcaatgcgctgaactccggcgccaaggtgttc
atggccgacttcgaagattccaccgcgccgacctggcgcaacctgctggccggccagcgc
accctggctgcggcggtgcgcggtgacctcagcttcgatgcgcccaacggcaagcactac
gccctgcgcccggaggccgaacgtgcagtgctgatcgtgcgcccgcgcggctggcacctg
gacgaaaagcacgtgttgatcgacggccagccgttggccggcggcctgttcgatgcggcg
ctatttgccttccacaatggccgagcgttgttggccaaggaccgcggcccgtacctgtac
ctgcccaagctgcagagcatggaagaagccgcactgtgggacaccgcgctggcgcatatc
gaagcgatgctgggcctgccgcatgggcagatcaaggtcaccgtgctgatcgaaacgctg
ccggcggtgttcgagatggacgaaattctccatgcgctgcgcgagcgcatcgtgggcctg
aactgcgggcgttgggactatatcttttcctacctgaaaacctttcgggcgcaccgcgac
cgcgtgctgcccgaacgcggccaggtcaccatgacccagccatttttgaaggcctattcg
gagctgttgatcaagacctgccatcgccgcggtgcgcatgcgatgggcggcatggccgcg
cagattccgatcaatcacgatgaagccgccaacgaacaggccatggcccgcgtgcgtgcc
gacaagttgcgcgaagtgaccgccggccacgatggcacctgggtggcgcatccggcgctg
attccggtggcgatgaaactgttcgacgaacacatgcccaccgcgcatcagcagcatgta
gtgcgcaatgacgtgcaggtgacgcgcgacatgttgatcgcgccctcgccgggcaatgtc
acccgcgccgggttcgaaggcaatgtcgaagtgtgcgtgcgctatctggcggcctggctg
gacggcaatggctgcgtgccgatccaccacctgatggaagacgccgccacggccgaaatc
agccgcgcgcagctgtggcagtggttgcatcacggccagcacctggatgatggcaccgcc
atcgatcaacacttgctgcaggccaccttgcgcgcactgcctgcacggctgggaaccgcc
accgcgctgcccggcgctgcacggatcgatgaagcgatcgccttactcgaagagttgagc
cgcgccgacgaactggcggacttccttaccgtaccggcgtaccgcctgatcgattga

DBGET integrated database retrieval system