KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0334Help
Entry
XACM_0334         CDS       T01616                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xax  Xanthomonas alfalfae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XACM_0334
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XACM_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
380702..382063
Genome map
AA seq 453 aa AA seqDB search
MSDHPSPRRVPAASSHSTTPPVAGGISRRRVLQGAAGAAVVATTGWAGHAAAQSASLPFA
GLNLSGLASNSYVENAEIGTHYRAITAQHVAAAGSCPLFRLPTTAARFTRGQGAPLNESY
CRQVQDALDNIAARGKRAIVELHDYMRLPQRVAAKSGYRRDASGAVVDARGNRVGDLAAA
GLWADTYPLRNFNYVGYLDSRDQLLKLYEYRVIGTPGCTLYNDAGLPDLWARLVNRFKQH
PAVFGWGVMNEPYQGAERNADGSVLSMAAHWQKTATACSKAIIDRDRNHFVFVCGNGYAS
ARRWQDDSMGLFDIPDPYDCIVYEAHNYLDSDGSGGGNWIGPGGRNEVIKPDTGIDMVSP
FIEALQQAGKRGYLGEHGYPAGNRSAEIATTRMLAHLQAYNIPSTQWCFGPGWPDDDVLG
MSRDVGADIQAKANLAAVQAFFDVRLSSYVPPR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccatccctctccacgccgcgtaccagcggcatcatctcactccaccacgcca
ccggtcgccggcggcatcagccgccgtcgcgtgctgcaaggcgcggccggcgctgcggtc
gtggccaccaccggttgggcaggccatgcggccgcgcaaagcgccagcctgccgttcgct
ggcctcaacctgtccggtctggcctccaatagctatgtggagaacgccgagatcggcacg
cattaccgcgccatcactgcccagcatgtggccgcggcggggagctgcccgctcttccgt
ctgccgaccactgccgcgcgcttcacgcgtggacagggcgcgccgttgaacgagagctac
tgcaggcaggtgcaggacgcgctggacaacattgctgcgcgcggcaagcgcgccatcgtg
gagttgcacgattacatgcggctgccgcagcgggtggcggccaaaagcggttatcggcgc
gatgccagcggtgcagtggtcgatgcgcgtggcaaccgtgtcggcgacctggcggcggcc
gggttgtgggccgacacctacccgctgcgcaacttcaattacgtgggctatctggacagt
cgcgaccaactgctcaagctctacgaataccgggtgatcggcacgccggggtgcacgctc
tacaacgacgccggcttgccggatctgtgggcgcgtctcgtcaaccggttcaagcagcac
ccggcggtgttcggctggggcgtcatgaacgagccgtaccagggcgccgagcgcaacgcc
gatggcagcgtactgtcgatggccgcacattggcagaagaccgccaccgcctgctccaag
gccatcatcgaccgcgatcgaaaccatttcgtgttcgtgtgtggcaacggctatgccagc
gcccggcgctggcaggacgattcgatgggcctgttcgacatcccggacccatacgattgc
atcgtgtacgaggcgcacaactatctcgacagcgatggcagcgggggcggtaactggatc
gggcccggtggacgcaacgaggtgatcaagccggataccggcatcgacatggtcagcccg
ttcatcgaagcgctgcagcaggccggcaagcgcggttatctgggcgagcacggctatccg
gccggcaatcgcagcgcggagatcgccaccacgcgcatgctggcgcacttgcaggcctac
aacattcccagcacgcagtggtgcttcggccccgggtggccggacgacgacgtgcttggc
atgagccgcgacgtgggtgcggacatccaggccaaggccaatctggcggccgtgcaggcg
tttttcgacgtgcgcctgtccagctacgttccgccccgctag

DBGET integrated database retrieval system