KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0346Help
Entry
XACM_0346         CDS       T01616                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xax00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(394091..395590)
Genome map
AA seq 499 aa AA seqDB search
MEKQYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWVEHNPREIMTSVYTTI
TELLNNAQIDARAIAGIGITNQRETAVVWDKATGQPIYNAIVWQSRQTKDICTQLKEAGH
EQMVREKTGLLIDAYFSGTKVKWILDHVEGARERAQKGELAFGTIDSWLIWNLTGGKVHV
TDYTNASRTMMFNIHTLEWDAELLAMLDVPAQMLPDVRSSSEIYGMTQTQYFYGEQVPIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMNTGDKAVASKAGLLTTIAWGIDGKVEY
ALEGAIFVAGSVVQWLRDGLRMLGKASDSQAYAERAGDNDGVYIVPAFVGLGAPYWRSDI
RGAVFGLTRGTTKEHFVRAAVESMAYQTRDVLTAMQSDSGIELKELRADGGAIANDFMAQ
FQSDILNVPVLRPEVAETTALGAAYLAGLATGFWGSREEIAKQWAVDRRFEPAMADDKRQ
GLYAGWQQAVEATMGFRIS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcagtacgtccttgcgatcgatcaaggcaccaccagctcacgcgcgatgttg
ttcgaccgccagggcaaggtggccggcgtggcgcagcgcgaattcggccagatctttccg
cagccgggttgggtggaacacaacccgcgcgagatcatgaccagcgtctataccaccatc
accgagctgctcaacaacgcgcagatcgatgcgcgcgcgatcgccgggatcggcatcacc
aaccagcgcgagaccgcggtggtgtgggacaaggccaccggccagccgatctacaacgcc
atcgtgtggcaatcgcggcagaccaaggacatctgcacccagctcaaggaggccgggcat
gagcagatggtgcgcgagaagaccggcctgctgatcgatgcgtatttttccggaaccaag
gtcaagtggattctcgaccacgtcgaaggcgcgcgcgaacgcgcgcagaaaggcgaactg
gcgttcggcaccatcgacagttggctgatctggaatctcaccggcggcaaggtgcacgtc
accgactacaccaatgcctcgcgcaccatgatgttcaacatccacacgcttgagtgggat
gctgaactgctggccatgttggacgtgcctgcgcagatgctgccggacgtgcgttcgtcc
agcgagatctatggcatgacccagacccagtacttctatggcgaacaggtgcccatcgcc
ggcatcgccggcgaccagcaggccgcgttgttcggccaggcctgcttcgaaccgggcatg
gcgaaaaacacctatggcaccggctgtttcatgctgatgaataccggcgacaaggcggtg
gcgtccaaggccggtttgctgaccacgattgcctggggcatcgacggcaaggtcgaatac
gcgctggaaggcgcgatcttcgttgccggctcggtggtgcagtggctgcgcgatggcttg
cgcatgctgggcaaggccagcgactcgcaagcctatgccgagcgtgccggcgacaacgat
ggcgtgtacatcgtgccggccttcgtcggcctgggcgcgccgtactggcgcagcgacatc
cgcggcgcggtgttcgggctgacgcgtggtaccaccaaggaacacttcgtgcgtgcagca
gtcgaatcgatggcctaccagacccgcgacgtgctcaccgcgatgcaaagcgattccggc
atcgagctgaaagaactgcgtgccgacggcggtgccatcgccaacgacttcatggcgcag
ttccagagtgacattctcaatgtgccggtactccgcccggaagtcgcggaaaccactgcg
ctgggtgcggcgtatctggcagggcttgcgactgggttctggggcagccgcgaagaaatc
gccaaacagtgggccgtggatcgccgcttcgaaccggccatggccgacgacaagcgccaa
gggctctacgccggctggcagcaagcagtggaagcgacgatgggattccgcatcagctga

DBGET integrated database retrieval system