KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0418Help
Entry
XACM_0418         CDS       T01616                                 

Gene name
glgB2
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xax00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473524..475707
Genome map
AA seq 727 aa AA seqDB search
MTTEGISETSQTLQALANGLPADAFAVLGPKPLADGRRQVRVLAPGAEAMGLIDPRGKLL
ARMQASAIDGVFEGILAADGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQA
VRRALGAQHVHCGDVPGVRFAVWAPHAQRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPR
VEAGARYKYAVTAADGRVLLKADPVARQTELPPATASVVPSAAAFAWTDAAWMANRDPGA
VPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWG
YQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEH
ADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIEHYHLDGLRVDAVASMLYRDYGRAE
GEWVPNAHGGRENLEAVAFLRQLNREIATQFPGVLTIAEESTAWPGVTAAISDGGLGFTH
KWNMGWMHDTLGYMQRDPAERAQHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQM
PGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQ
LVGDLNAALRRTPALYRGSHRADGFDWSVADDARNSVLAFVRHDPAGGAPLLAVSNLTPQ
PHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTLPPLAT
IYLQAEK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggaagggatctcggaaacgtcgcagaccctgcaagccctggccaacggcttg
ccggccgatgcctttgcggtgcttggaccgaaaccgctggccgatggccgccgtcaggtg
cgcgtgttggcaccgggcgccgaggcgatgggcttgatcgacccgcgcggcaagctgctc
gcgcgcatgcaggccagcgccatcgatggcgtcttcgaaggcatcctggcggccgatggg
ccgtaccggctgcgcatcgtgtggccagacagggtgcaggaggtcgaagacccgtacgcg
ttcgcggccacgttggacgaatcgctgttgctgcagatcgctgccggcgatggccaggcc
gtgcgtcgtgcgctgggcgcgcagcatgtccactgtggcgatgtgccgggcgtgcgcttt
gcggtgtgggcaccccatgcccaacgcgtggcggtggttggcgacttcaacggctgggac
gtgcggcggcatccgatgcggcagcgcatcggtggcttttgggaactcttcctgccgcgc
gtggaagccggcgcccggtacaaatatgccgtcaccgcagccgatgggcgggtgctgctc
aaggccgacccggtggcccggcaaaccgaattgccgccggcaaccgcttcggtggtgccc
agcgccgccgcattcgcctggaccgatgcggcctggatggccaaccgcgaccccggcgcc
gtgccggcgccgctgtcgatctacgaggtgcatgccgcctcctggcgccgcgacggacac
aaccaaccgctggactggccaacgctggccgagcagttgattccttacgtacagcagctc
ggcttcacgcatatcgaattgctgccgatcaccgaacacccgttcggcggttcctggggc
tatcagccgctgggcctgtatgcgcccaccgcgcgccatggcagcccggacggctttgcg
cagttcgtcgatgcctgtcaccgcgccgggatcggcgtgatcctggattgggtcagcgcg
cactttcccgatgacgcgcacggcctggcccagttcgacggcgccgcgctgtacgagcat
gccgacccgcgcgaaggcatgcatcgcgactggaatacgctgatctacaactacggtcgg
ccggaagtgaccgcttacctgctgggcagcgcgctggaatggatcgagcattaccacctc
gacggcctgcgcgtggatgcggtggcctcgatgctgtatcgcgactacggccgcgccgaa
ggcgagtgggtgcccaatgcgcatggcggccgcgagaacctggaggcggtcgcgttcctg
cgccagctcaaccgcgaaatcgccacccagttccccggcgtgctcaccattgccgaagaa
tccaccgcctggccgggcgtgaccgccgcgatcagcgatggcggcctgggcttcacccac
aaatggaacatgggctggatgcacgacacgctgggctacatgcagcgcgatccggccgaa
cgtgcgcagcaccatagccagctcaccttcgggctggtgtacgccttcgacgaacgcttc
gtgttgccgctctcgcacgatgaagtggtgcacggcaccgggggcctgctcgggcagatg
ccgggcgatgactggcgccgcttcgccaacctgcgcgcctacctggcgctgatgtgggcg
cacccgggcgacaaactgctgttcatgggcgccgagttcggccaatgggccgactggaat
cacgaccagtcgctggactggcatctgctggacggcgcgcgccatcgtggcatgcagcaa
ctggtgggcgatctcaacgccgcactgcgccgcacgccggcgctgtatcgcggcagccat
cgcgccgacggcttcgactggagcgtggccgacgatgcgcgcaacagcgtgctggcgttc
gtccgccacgatcctgccggcggcgcaccgttgctggcagtgagcaacctcaccccgcaa
ccgcatcacgactatcacgtgggggtgccgcgtgctggcctctggcgcgagatcctcaac
accgacagtgcccattacggcggcagcaacctcggcaacagcggtcgcctggcgaccgag
ccggtgggcatgcatgggcatgcgcaacgtctgcgcctgaccctaccgccgctggccacg
atctatctgcaagcggagaaataa

DBGET integrated database retrieval system