KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0436Help
Entry
XACM_0436         CDS       T01616                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00010  Glycolysis / Gluconeogenesis
xax00020  Citrate cycle (TCA cycle)
xax00620  Pyruvate metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
Module
xax_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_0436
   00020 Citrate cycle (TCA cycle)
    XACM_0436
   00620 Pyruvate metabolism
    XACM_0436
Enzymes [BR:xax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XACM_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEO40745
UniProt: G2M1L6
Position
complement(499787..501295)
Genome map
AA seq 502 aa AA seqDB search
MSDNKNFHLPDLGEGLPDATIVEWFVKEGDTVRLDDPLVSMETAKAVVEVPSPFSGTVVK
LAGAAGDVIVTGSVLAQFALDASQPQRADGQDTGHSHGPAPTHAPTPSTGDSAAGHTTRV
VASDNGGEIADADAGDGSGDRDDAGTVVGAMQSSNAVQSEQAITVGGVRAMPVVRALARK
LRVDLAQVRATGPDGTVTLADVKQAAAAGTAQPSPGAHGAPTSPARGRGGPIDDGGRAAG
IAADGRDRPATAPLLPPAGEGARRADEGNARSTLSASGKPMRTQSPGISAKGQPEQLKGV
RRNMARVMADAHTKVVPTTLNDDADLHAWQPGNDVTVRLVRGIVRACQAVPALNAWFDGD
ALSRTLHHQVDIGIAVDTEEGLFVPALRNADMLDAHGIREGVNRLRQQVESRSIAASELS
GYTISLSNFGMFAGRYATPVVVPPCVAIVAAGRARYQLTPVMGGVETHKVMPLSLTFDHR
AATGGEAARFLRALLDDLALAN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacaagaatttccacctgcccgacctgggcgaaggcctgcccgacgccacc
atcgtggaatggttcgtcaaggagggcgacaccgtgcgcctggacgacccgttggtgtcg
atggaaaccgccaaggcggtggtcgaggtgccctcgccgttttccgggaccgtggtcaag
ctcgccggcgccgccggcgatgtgatcgtgaccggctcggtgctggcgcagttcgcgctg
gatgcctcgcagccgcaacgcgccgacggccaggacaccggccattcgcatggaccggcg
ccgacgcacgcacccacgcccagcaccggcgacagcgcggctgggcacaccacgcgcgtg
gtggcctccgataacggcggcgaaattgccgatgccgatgctggcgatggcagcggcgat
cgcgacgatgccggcaccgtggtcggcgcgatgcagagctccaacgccgtgcagagcgag
caggccattaccgtcggcggcgtgcgcgccatgccggtggtgcgcgcgctggcgcgcaag
ctgcgtgtggacctggcacaggtgcgcgctaccggcccggacggcacggtcacgctggca
gacgtaaagcaggcagcggccgccggtaccgcgcagccctcacccggcgcgcacggcgcg
ccgacctctcctgcccgcgggcgaggtggtccgatcgatgacggtgggagagctgctggg
atagctgccgacggcagggatcgacccgcaacagcaccccttcttccgcctgcgggagaa
ggtgcccgcagggcggacgagggcaacgcccgctccacgctgtcggccagcggcaagccg
atgcgcacccagtcgcccggcatcagcgccaagggccaacccgagcaactcaagggcgtg
cgccgcaacatggcacgtgtgatggccgatgcacacaccaaggtggtgccgaccacgctc
aacgacgatgccgatctgcacgcctggcagcccggtaacgatgtcaccgtgcgtctggtg
cgcggcatcgtgcgcgcctgccaggcggtgcccgcactcaatgcctggttcgacggcgac
gcactcagccgcaccctgcaccaccaagtcgacatcggcattgccgtggataccgaagaa
ggcttgttcgtgccggcgttgcgcaacgccgacatgctggatgcgcatggcattcgcgaa
ggcgtcaaccggttgcgccagcaggtggaaagccgcagcatcgccgcgtccgaactgagc
ggctacaccatctcgctgtccaacttcggcatgtttgccggccgctacgccacgccggtg
gtggtgccgccctgcgtggcgatcgtggccgccggccgcgcgcgctaccaactcaccccg
gtgatgggcggagtggaaacgcacaaggtgatgccgctgtcgctgaccttcgatcaccgc
gccgccaccggcggtgaagcggcgcgcttcctgcgcgccttgctggacgatctggcgttg
gccaactga

DBGET integrated database retrieval system