KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0474Help
Entry
XACM_0474         CDS       T01616                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01130  Biosynthesis of antibiotics
xax01230  Biosynthesis of amino acids
Module
xax_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XACM_0474 (trpC)
Enzymes [BR:xax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XACM_0474 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEO40783
UniProt: G2LQ84
Position
540997..541794
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAMQASIAAGDPAVIAEV
KKASPSKGVIRPDFQPADIAVSYEFGGATCLSVLTDVDFFQGSDAYLRQARDACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDAQLADLSGLAMQLGLDVLVEVHDIDELERA
VQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRDRVLVTESGIVTQADVQLMRSHDVNA
FLVGETFMRAAEPGESLRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcaacaccattcttgcccgcaaggccgacgaagtcgccgagcgcagt
gcgcgcgtgccgctggccgagttgatcgcgcgcagcgccgacctgccgctcacgcgcgga
tttgcagctgccatgcaggccagcatcgccgcaggcgacccggccgtgattgccgaagtg
aagaaggccagcccgtccaagggtgtcatccggccggacttccagccggccgatatcgcg
gtcagctatgaattcggtggcgcgacgtgcctgtcggtgctcaccgatgtggatttcttc
cagggatcggatgcctatctgcgccaggcgcgcgacgcctgcacgctgccggtgctgcgc
aaggatttcaccgtcgacccgtatcaggtctacgaagcccgcgtgctcggcgccgactgc
atcctgctgatcgtgtccgcgctggaagacgcccaactggccgatctatcgggcctggcc
atgcagctgggcctggacgtgctggtggaagtacacgacatcgacgagctcgagcgtgcg
gtgcaggtgccggtgcccttgatcggcatcaacaatcgcaacctgcgcaccttcgaagtg
acgctgcagaccacgttggacatgcgcgcggcggtgccgcgcgatcgcgtgctggtcacc
gagagcggcatcgtcacccaggccgatgtgcaactgatgcgcagtcacgatgtgaacgca
tttctggtcggcgagaccttcatgcgcgcggccgaacccggcgagtcgctgcgtcagcta
ttcttcgcgcatgactga

DBGET integrated database retrieval system