KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0691Help
Entry
XACM_0691         CDS       T01616                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xax00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
793251..793766
Genome map
AA seq 171 aa AA seqDB search
MTTVLLSLGSNVQPTHYLRLAVVALRARFGQIVVSPAYRTPAVGFEGPDFVNNAVVLQTD
LELDALDHWLHALEDAHGRDRSGPRFSDRTLDLDVVFFGDRIVEGPGHLRIPRPELKHAF
VLKPLADIAPDFVDPLSGQALAALWQAHPQYGSAFATVELDAAAPQLSVTQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtgcttctcagcctcggcagcaacgtccagccgacccactacctgcgcctg
gctgtcgtcgccctgcgcgcgcgctttggccagatcgtcgtgtcacccgcgtaccgcacg
cctgcggtgggcttcgaagggccggacttcgtcaacaacgcggtggtcttgcagaccgat
ctggagctggacgcgctggatcactggctgcatgcactggaagatgcgcatgggcgcgat
cgcagcggcccgcgtttcagcgaccgcaccctggatctggacgtggtgttctttggcgac
cgtatcgtcgaaggccccgggcatctgcgcatcccgcggcccgagctcaagcacgcattc
gtgctcaaaccgctggccgacatcgcgccggacttcgtcgacccgctgagcgggcaggcg
ttggcagccctgtggcaggcgcacccgcagtacggcagcgcgtttgccacggtggagctg
gatgcggctgcgccgcagttgagcgtcacgcaatag

DBGET integrated database retrieval system