KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1078Help
Entry
XACM_1078         CDS       T01616                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xax03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1189894..1190487
Genome map
AA seq 197 aa AA seqDB search
MSTLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALGNAVEKVGHCVQCRD
FTESEICSICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFILQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttgctcgaacaactgatcgaggccttccgggtattgcccggcgtgggccag
aagtcggcccagcgcatggcctatcacgtgctcgagcgcgagcgcgagggtgggcggcgg
ctggccgctgcgttgggcaacgcggtggaaaaggtggggcattgcgtgcaatgccgcgac
ttcaccgaatcggaaatctgcagcatttgcgccagcagcagccgcgaccggcagcaacta
tgcgtggtggagtcgccggccgatcgcctggcgatcgaacatgccaccggctaccgcggg
ctgtatttcattctgcaggggcgcctgtcgccgctggatggcatcggcccgcgcgaactg
gggctggatcggctcggcgagcgtctggctgccggcgaagtgaccgaaatgatcatcgcc
accaatgcgacggtcgaaggcgaagccacggcccattacctggcgcaactggcgcgccag
cacgcagtacgcccaagccggctcgcccagggcatgccgctgggtggcgagctggagtat
gtggaccgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctttga

DBGET integrated database retrieval system