KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1078Help
Entry
XACM_1078         CDS       T01616                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xax00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XACM_1078 (recR)
DNA repair and recombination proteins [BR:xax03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     XACM_1078 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XACM_1078 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim TniQ
Motif
Other DBs
NCBI-ProteinID: AEO41365
UniProt: G2LV31
Position
1189894..1190487
Genome map
AA seq 197 aa AA seqDB search
MSTLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALGNAVEKVGHCVQCRD
FTESEICSICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFILQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttgctcgaacaactgatcgaggccttccgggtattgcccggcgtgggccag
aagtcggcccagcgcatggcctatcacgtgctcgagcgcgagcgcgagggtgggcggcgg
ctggccgctgcgttgggcaacgcggtggaaaaggtggggcattgcgtgcaatgccgcgac
ttcaccgaatcggaaatctgcagcatttgcgccagcagcagccgcgaccggcagcaacta
tgcgtggtggagtcgccggccgatcgcctggcgatcgaacatgccaccggctaccgcggg
ctgtatttcattctgcaggggcgcctgtcgccgctggatggcatcggcccgcgcgaactg
gggctggatcggctcggcgagcgtctggctgccggcgaagtgaccgaaatgatcatcgcc
accaatgcgacggtcgaaggcgaagccacggcccattacctggcgcaactggcgcgccag
cacgcagtacgcccaagccggctcgcccagggcatgccgctgggtggcgagctggagtat
gtggaccgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctttga

DBGET integrated database retrieval system