KEGG   Xanthomonas alfalfae: XACM_1146Help
Entry
XACM_1146         CDS       T01616                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xax  Xanthomonas alfalfae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    XACM_1146
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XACM_1146
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     XACM_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1271272..1272591
Genome map
AA seq 439 aa AA seqDB search
MRASTAAAPVAGHALTEKENSIFVNPQRQFQQVLGIGGAITDSSAETFAKLPKRTQRALL
TAYYDPQQGIGYTLARTTIHSSDFSSGSYTYIKEGDAALKSFSVKHDAKYRIPMLRQAIA
AAGGKLTTFASPWSAPAFMKDSKTMLKGGKLLPEYAQAWASYYTRFIAAYEKAGIPIWGI
SLQNEPMAVQTWESMLFSAEEERDFLKHHLGPTMASAGYGDRKIIVWDHNRDMMVHRAHV
IFDDPEAAKYAWGMGFHWYETWAGFEPMVENVAAVAQAYPDKHLLLTEAAVEKFDPAKLQ
YWPNGERYGTAIINDLNHGAVGWTDWNILLDQHGGPNHVGNYCFAPVHADTRTGEVIYTP
SYWYIGHFSKFIRPGARRVSAASSRSNLATTAFLNTDGSLAMVVMNASDAAIAYNLYVGE
ASSTLEIPAHAIQTVVLAQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccagcacggcggccgctcctgtcgccggccatgcattgaccgaaaaagaaaac
tccatcttcgtcaatccgcagcggcagtttcagcaggtgctgggtatcggtggtgcgatc
accgattccagcgcagagacctttgccaagctgcccaagcgtacgcaacgtgcgttgctc
acggcctactacgatccgcaacagggcatcggctacacgctggcgcgcaccaccatccat
agctcggatttcagtagcggcagctacacctacatcaaggagggcgatgcagcgctgaag
agcttttcggtcaagcacgatgccaagtaccgcatcccgatgttgcgccaggcgattgcg
gcggccggcggcaagctcaccacgtttgccagcccatggagcgcgccggccttcatgaaa
gacagcaagaccatgctcaagggcggcaagctattgcccgagtacgcgcaggcctgggca
agctactacacgcgctttatcgcggcatacgaaaaagcgggcatcccgatctggggcatc
agcctacagaacgagccgatggcggtgcagacctgggagtcgatgctgttttcggccgag
gaagaacgcgactttttgaagcatcatctcgggcccaccatggccagcgccggctacggc
gatcgcaagatcatcgtgtgggaccacaaccgcgacatgatggtgcaccgcgcgcatgtg
atcttcgacgatccggaggcggcgaaatatgcgtggggcatgggctttcattggtatgaa
acctgggccggattcgagccgatggtggagaacgtggcggcagtggcgcaggcgtacccg
gacaagcacttgctgttgaccgaagcggcggtggaaaagttcgacccggccaagttgcag
tattggcccaatggcgagcgctacggcacggccatcatcaacgacctcaatcatggcgca
gtgggctggacggactggaacattctgctcgaccaacacggtgggccgaaccacgtgggc
aattattgctttgcgccggtacatgccgatacgcgcacgggcgaggtgatctacacgccg
agctattggtatatcggccacttttccaaattcatccggccgggtgcacgacgggtcagc
gcagccagcagccgtagcaatctggcaaccaccgcgtttctcaacaccgatggcagcctg
gccatggtggtcatgaatgccagcgacgctgcgattgcttacaacctgtatgtgggcgag
gcatccagcacgttggagattccggcgcatgcgatccagaccgtggtactggcgcagtaa

DBGET integrated database retrieval system