KEGG   Xanthomonas alfalfae: XACM_1258Help
Entry
XACM_1258         CDS       T01616                                 

Gene name
cheR1
Definition
methylase of chemotaxis methyl-accepting protein
Orthology
K00575  
chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
xax  Xanthomonas alfalfae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:xax00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XACM_1258 (cheR1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XACM_1258 (cheR1)
Enzymes [BR:xax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     XACM_1258 (cheR1)
Bacterial motility proteins [BR:xax02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XACM_1258 (cheR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409320..1410144)
Genome map
AA seq 274 aa AA seqDB search
MNAVELFDLELRVLLEAVFQRYHYDFRDYAVSSLRRRMRHAMARFDCARVADLQHRLLHE
PDTFAQAMQFFTVQVSEMFRDPAYFRVLREHAVPVLRTYPSIKLWVAGCSTGEEVWSLAI
LLHEEGLLEKAVIYATDINPEALGMAEAGAYGIDRIAQFSRNYLDAGGRTSLSDYYTTAY
DGAVFDRRLKRNIVFADHSLATDTVFSEVHLVSCRNVLIYFNRSLQDRAVGLFYDALVHR
GFLGLGSKESLQFGAHAQAFEACAREQRLYRKAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggtagagctgttcgacctggaactgcgcgtgctgctggaagcggtcttccag
cgctatcactacgacttccgcgactatgcggtgtcgtcgttgcgacggcgcatgcgccac
gcgatggcgcgtttcgactgcgcgcgcgtggccgatctgcagcaccgtctgctgcacgag
ccggacaccttcgcgcaggcgatgcagttcttcaccgtgcaggtctcggagatgttccgc
gacccggcatatttccgcgtcctgcgcgagcatgcggtgccggtcttgcgtacctatccc
tcgatcaagctctgggtggcaggctgcagtaccggtgaagaagtctggtccctggccatc
ctgctgcacgaagaaggcctgttggaaaaggcggtgatctacgccaccgacatcaacccc
gaagcgctgggcatggccgaagccggcgcctatggcatcgatcgtatcgcgcagttcagc
cgcaattatctggacgccggtggccgcacctcgctgtcggactactacaccaccgcttac
gacggtgcggtgttcgaccggcgcctgaaacgcaatatcgtgttcgccgatcacagcctg
gccaccgacacggtgttttccgaagtccacctggtgtcatgccgcaacgtgctgatctat
ttcaaccgcagcttgcaggatcgcgcggtggggctgttctacgacgcattggtgcatcgc
ggatttctcggattgggcagcaaggagtcgctgcagttcggcgcgcacgcgcaggccttc
gaagcctgcgcgcgcgagcagcggctgtatcggaaggccgcatga

DBGET integrated database retrieval system