KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1258Help
Entry
XACM_1258         CDS       T01616                                 

Gene name
cheR1
Definition
methylase of chemotaxis methyl-accepting protein
Orthology
K00575  
chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xax02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xax02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409320..1410144)
Genome map
AA seq 274 aa AA seqDB search
MNAVELFDLELRVLLEAVFQRYHYDFRDYAVSSLRRRMRHAMARFDCARVADLQHRLLHE
PDTFAQAMQFFTVQVSEMFRDPAYFRVLREHAVPVLRTYPSIKLWVAGCSTGEEVWSLAI
LLHEEGLLEKAVIYATDINPEALGMAEAGAYGIDRIAQFSRNYLDAGGRTSLSDYYTTAY
DGAVFDRRLKRNIVFADHSLATDTVFSEVHLVSCRNVLIYFNRSLQDRAVGLFYDALVHR
GFLGLGSKESLQFGAHAQAFEACAREQRLYRKAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggtagagctgttcgacctggaactgcgcgtgctgctggaagcggtcttccag
cgctatcactacgacttccgcgactatgcggtgtcgtcgttgcgacggcgcatgcgccac
gcgatggcgcgtttcgactgcgcgcgcgtggccgatctgcagcaccgtctgctgcacgag
ccggacaccttcgcgcaggcgatgcagttcttcaccgtgcaggtctcggagatgttccgc
gacccggcatatttccgcgtcctgcgcgagcatgcggtgccggtcttgcgtacctatccc
tcgatcaagctctgggtggcaggctgcagtaccggtgaagaagtctggtccctggccatc
ctgctgcacgaagaaggcctgttggaaaaggcggtgatctacgccaccgacatcaacccc
gaagcgctgggcatggccgaagccggcgcctatggcatcgatcgtatcgcgcagttcagc
cgcaattatctggacgccggtggccgcacctcgctgtcggactactacaccaccgcttac
gacggtgcggtgttcgaccggcgcctgaaacgcaatatcgtgttcgccgatcacagcctg
gccaccgacacggtgttttccgaagtccacctggtgtcatgccgcaacgtgctgatctat
ttcaaccgcagcttgcaggatcgcgcggtggggctgttctacgacgcattggtgcatcgc
ggatttctcggattgggcagcaaggagtcgctgcagttcggcgcgcacgcgcaggccttc
gaagcctgcgcgcgcgagcagcggctgtatcggaaggccgcatga

DBGET integrated database retrieval system