KEGG   Xanthomonas alfalfae: XACM_1301Help
Entry
XACM_1301         CDS       T01616                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xax  Xanthomonas alfalfae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XACM_1301 (fadB)
   01212 Fatty acid metabolism
    XACM_1301 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XACM_1301 (fadB)
   00650 Butanoate metabolism
    XACM_1301 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    XACM_1301 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    XACM_1301 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XACM_1301 (fadB)
   00310 Lysine degradation
    XACM_1301 (fadB)
   00380 Tryptophan metabolism
    XACM_1301 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XACM_1301 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XACM_1301 (fadB)
   00281 Geraniol degradation
    XACM_1301 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XACM_1301 (fadB)
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XACM_1301 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XACM_1301 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XACM_1301 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1465506..1467584)
Genome map
AA seq 692 aa AA seqDB search
MLPGFDGLRFSHWQADLREDGVVVLSLDRQGAPVNAFSQEVLLELGAVVERLALDPPKGV
VLRSGKPNGFIAGADLKEFQEFDRKGTVNDAIHRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLTGRTVS
AKAARAMGLVDKVAAPAVLVDVAASLALAGTTRAFKQRATAWATNTLLARKLLAPQMRKQ
VARKARKEHYPAPYALINVWERAGGSGIQARLAAERKAVVKLASTPTARNLIRIFFLTER
LKALGGKDAAGAAAPIRHVHVIGAGVMGGDIAAWAAYKGFEVTLQDREQRFIDTALTRGG
ELFAKRVKDDAKRPAVAARLRGDLAGAGVTQADLVIEAIIENPQAKRDLYQSIEPQLKPD
ALLTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLAAFC
KALDKFPVPVAGTPGFLVNRVLFPYLLEAATAYAEGIPGPVLDKTAVKFGMPMGPIELID
TVGLDVAAGVGAELAPFLRLPIPAALATVEAGKRGKKDGQGLYKWENGRAVKPEVASGYT
APADLEDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQYIRSVGADA
LLERLHALHARYGERFAPRPGWDSPLLREAVA
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggccgatctgcgcgaggac
ggcgtggtggttctcagcctcgatcggcagggcgcaccggtcaacgcattttcgcaggag
gtgctgctggagctgggcgccgtggtcgagcggctggcactggatccgccaaagggcgtg
gtgctgcgctcgggcaagcccaacggcttcatcgccggcgccgatctgaaggaattccag
gaattcgatcgcaagggtacggtcaacgatgccatccaccgcgggcagcaggtcttccag
aagctggccgaactgccctgcccgaccgtcgcggcgattcatggcttctgcatgggcggc
ggtaccgaaatcgcgctggcctgccgctaccgcgtggcctccgatgacggcagcacccgc
atcgggctgccggagaccaagctgggcatctttcccggctggggcggcagcgcccgcttg
ccgcgcctgatcggtgcgccggccgcgatggatctgatgctcaccggccgcacggtatcg
gccaaggctgcgcgcgcgatggggctggtcgacaaggtcgccgcgcctgccgtgctggtg
gatgtggcagccagcctggcgctcgccggcaccacgcgtgcgttcaagcagcgcgccact
gcgtgggccaccaataccttgctcgcgcgcaaactactggcgccgcagatgcgcaagcag
gtggcgcgcaaggcgcgcaaggagcattacccggcgccctacgccctgatcaacgtctgg
gagcgggcgggcggcagcggcatccaggcgcgcctggcggccgagcgcaaggcggtggtc
aaacttgccagcacgccgaccgcacgcaacctgatccgcatcttcttcctgaccgagcgc
ctgaaagcgctgggcggcaaggacgcagccggtgcggcggccccgattcgccatgtgcat
gtgatcggcgccggcgtcatgggcggtgatatcgcggcctgggcggcttacaagggcttc
gaggtcacgttgcaggaccgcgagcagcgttttatcgatacggcgctgacacgcggcggc
gagctgttcgccaagcgcgtcaaggacgatgccaagcggccggcagtggccgcgcggctg
cgcggcgacctggccggcgcgggcgtgacgcaggccgacctggtgatcgaggcgatcatc
gaaaacccgcaggcaaagcgcgatctgtaccaatcgatcgagccgcaactcaagccggat
gccttgctgacgaccaatacctcgtcgattccgctgaccgaattgcgtggccacatccag
cgcccggcgcaatttgccggcctgcactacttcaacccggtggcgatgatgccgctggtg
gaaatcgtgcagcacgatggtctggatccggccaacgtcgcgcgcctggctgcgttctgc
aaggccttggacaagttcccggtgccggtggccggcacgccgggattcctggtcaaccgg
gtgctgttcccctacctgctcgaggcggccaccgcgtatgccgaaggcattcctggcccg
gtgctggacaagacggcggtgaagttcggcatgccgatggggccgatcgaactgatcgac
accgtgggcctggatgtggcggcgggcgtaggcgcggagctggcgccgttcctgcgtttg
cccatcccggcggcactggcgaccgtggaagccggcaagcgcggcaagaaggacggccag
ggcctgtacaagtgggagaacggacgcgccgtcaaacccgaggttgccagcggctacacc
gcaccggcggatctggaagaccgcctgatcctgccgctgctcaacgaagcggtggcctgc
ctgcacgatggcgtggtggccgacgcagacctgctggacgccggggtcatcttcggcaca
ggcttcgcacctttccgtggcggcccgatccagtacatccgcagcgtcggcgcagacgcg
ctgctggagcgcctgcacgcgctgcatgcacgctatggcgaacgcttcgcgccgcgcccg
ggttgggactcgccgttgttgcgggaagcggtggcctga

DBGET integrated database retrieval system