KEGG   Xanthomonas alfalfae: XACM_1317Help
Entry
XACM_1317         CDS       T01616                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xax  Xanthomonas alfalfae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XACM_1317
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    XACM_1317
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XACM_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483880..1484884
Genome map
AA seq 334 aa AA seqDB search
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFASRTQVAELSAAIRAAAPRPVLVCVD
QEGGRVQRFREGFSALAPLQSFGAQYAQDPESALAAARAHAQLMASEVRASGVDLSFAPV
VDLGRGNRAIGDRAFSDDPQIVATFTRAYVQALHGAGMAATLKHFPGHGTVLEDTHVDHA
SDPRPLEVLQAEDLVPFVAGIEAGADAVMMAHVVYPQVAPEPAGYSQRWIEQILRGQMGF
RGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCDVVLVCHPELVAESLQAVQGRSLNTAAL
IGLIGRGALGWDGLLAGTDASFTTPPSAHFGTTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgatcggcgttgccggtaccgaactcagcgcacaggaacgcgattggctgcag
cacgatgcggttgccggcgtggtgctgttcaagcgcaacttcgcctcgcgcacccaggtg
gccgagctgtcggctgccattcgcgccgccgcgccgcgcccggtgctggtctgcgtggac
caggaaggtgggcgcgtgcagcggtttcgcgaaggattcagcgcgctggcgccgctgcaa
agcttcggtgcgcagtacgcgcaagacccggagtctgcactggccgccgcgcgcgcgcat
gcgcagttgatggccagcgaggtccgcgccagcggcgtggacctgagctttgccccggtg
gtggacctggggcgcggcaaccgcgccatcggcgatcgcgccttcagcgacgacccgcag
atcgtggcgaccttcacgcgcgcctatgtacaggcgctgcatggcgccggcatggccgcc
acgctcaagcattttcccggccacggcaccgtgctggaagacacccatgtcgaccacgcc
agcgacccacggccgctggaggtgctgcaggccgaagacctggtgccgttcgtggcgggg
atcgaggccggcgccgacgccgtgatgatggcgcacgtggtttacccgcaggtcgcgccg
gagccggccggctattcgcagcgctggatcgagcagatcctgcgcggccagatgggcttc
cgcggcgtggtcttttccgacgacatcggcatggctgcctcgttcagtgccggcggggtg
gcgggccgggtgcatgcgcatctggatgccggctgcgacgtggtgctggtgtgccatccg
gagctggtcgccgaatcgctgcaggccgtgcagggccgcagcctcaataccgctgcattg
atcggcctgatcggccgcggcgcactaggctgggatggcctgcttgccggcaccgacgcc
tcatttaccactcctccttctgcccatttcggaacaactgcctga

DBGET integrated database retrieval system