KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1421Help
Entry
XACM_1421         CDS       T01616                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xax01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:xax00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1591937..1593067
Genome map
AA seq 376 aa AA seqDB search
MSDVLELTCDLIARASVTPADAGCQAAIAQRLRAAGFGCERLRLGEVENLWATHGSGAPV
LVLLGHTDVVPPGPREAWTSDPFDPQIRDGVLYGRGAADMKGSVAAFVVAAEQFVAAHPT
HSGTLAVLLTSDEEGDAIDGVRRVAEVFRERGQTIDWCITGEPSSTERLGDLLRVGRRGS
LSGTLTVKGVQGHVAYPHKARNPIHLAAPALAELVARQWDDGFESFPPTSLQLSNIHAGT
GANNVIPGELQVAFNLRYTPHWDAPRLEAEITALLDRHALDYTLRWHRSGEPFYTPEGRL
RSVAREVLGEFAGAPPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQVDEHVRVADLQ
ALPALYRTLIERLLVE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtgctggagttgacctgtgacctcattgcacgtgcctcggtaacgccggca
gatgccggttgccaggccgcgattgcgcagcgcctgcgcgcagccggcttcggctgcgag
cgcttgcgcctgggcgaggtcgagaatctgtgggcaacccatggcagcggtgcgccggtg
ctggtgttgctcgggcataccgatgtggtgccgccgggcccgcgcgaggcgtggaccagc
gacccgttcgatccgcagatccgcgacggcgtgttgtatgggcgtggtgcagcggacatg
aaaggcagcgtggccgcgttcgtggtcgccgcagagcaattcgtcgctgcacacccaacg
cactccggcacgctggcggtgctgttgacctcggacgaagagggcgatgccatcgatggc
gtgcgccgggttgccgaggtgtttcgcgaacgcgggcaaacgatcgactggtgcatcacc
ggcgaaccgtcgtccaccgagcgcctgggcgatctgttgcgcgtgggccgtcgcggcagc
ctgtccggcacgttgaccgtgaagggtgtgcaggggcatgtggcgtatccgcacaaggcg
cgcaaccccatccatctggcagcgcctgcgctggccgaactggtggcgcggcaatgggac
gacggcttcgaaagctttccgcccaccagcctgcaactttccaacatccacgccggcacc
ggcgccaataacgtgattcctggcgagctgcaggtggccttcaatctacgctatacgcca
cactgggacgcgccgcgcctggaagctgaaatcaccgcgctgctcgatcggcatgcgctg
gactacacgctgcgctggcaccgcagcggcgagccgttctataccccggaagggcggttg
cgcagcgtcgcgcgtgaggtcctgggggagttcgccggtgcgccgccggaagaaagcacc
gggggcggcacctccgatgcgcggttcattgcgccactgggtgcgcaatgcatcgaagtg
ggcccggtcaatgccagcatccaccaggtcgacgagcatgtgcgcgtcgccgacctgcag
gcgctaccggcgctgtaccgcacgttgatcgagcgcctgctggtcgagtga

DBGET integrated database retrieval system