KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1452Help
Entry
XACM_1452         CDS       T01616                                 

Gene name
pldA
Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:xax00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:xax00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xax00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:xax00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:xax00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1632436..1633446)
Genome map
AA seq 336 aa AA seqDB search
MPLASCYDKALGYTPQQTAEADAAAQLAKQKEARPDDTRTISRVGDFFRADGQDQPKEEA
VANAGRGSLLDRRWELAKDSKLGTFQLRGYKPVYLLPAFWTSDTNRTPQSPNPANSVNTP
QQLDSTELKFQLSFKTKVVEDLFGDNGDIWMGYTQSSRWQAYNADASRPFRETNYEPEAM
LVFRNNYSIFGWKGRMSGISLNHMSNGRADPLSRSWNRVILNFGLDRENWALTLRPWFRI
KEDRADDNNPDIEDYMGRGDATLVYNKDGHEFALIARHSLRGGDRSHGSVQLDYGFPITN
LLRGHVQVFDGYGESMIDYNHKATYIGVGVSLLEWF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgcctcctgctacgacaaggcactgggctacacgccgcagcaaaccgcggag
gcagatgccgccgcgcaattggccaagcagaaggaggccaggcccgacgatacgcgcacc
atcagccgggtcggcgatttcttccgcgccgacggccaggaccagccgaaagaagaagcc
gtggccaatgccggccgtggctccttgctggaccgccgctgggagctggccaaggattcc
aagctgggcaccttccagctgcgcggctacaagccggtatacctgttgccggcattctgg
accagcgacaccaaccgcaccccgcagtcgcccaatccggccaactcggtcaacacgccg
cagcagctggacagcaccgagctcaagttccagctcagcttcaagaccaaggtggtggaa
gacctgttcggcgacaacggcgatatctggatgggctacacccagagctcgcgctggcag
gcctacaacgccgatgcgtcgcgcccgttccgcgagaccaattacgagcccgaagcgatg
ctggtctttcgcaacaactacagcatcttcggctggaagggccgcatgagcggcatcagc
ctcaatcacatgtccaacgggcgcgccgacccgctgtcgcgctcgtggaatcgggtgatc
ctgaacttcgggctggatcgggagaactgggcgctgacactgcgcccgtggttccgcatc
aaggaagaccgcgccgacgacaacaatcctgatatcgaggattacatgggccgcggcgat
gcgacgctggtgtacaacaaggatggtcacgaattcgcgctgatcgcacgccattcgctg
cgtggcggcgaccgctcgcacggttcggtacagctggactacggcttccccatcaccaac
ctgttgcgcggccatgtgcaggtattcgatggctacggcgaaagcatgatcgactacaac
cacaaggcaacctatatcggtgtgggcgtgtcattgctggagtggttctaa

DBGET integrated database retrieval system