KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1505Help
Entry
XACM_1505         CDS       T01616                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00020  Citrate cycle (TCA cycle)
xax00310  Lysine degradation
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
Module
xax_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xax_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XACM_1505 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XACM_1505 (sucB)
Enzymes [BR:xax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XACM_1505 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H SAPS
Motif
Other DBs
NCBI-ProteinID: AEO41787
UniProt: G2LZ66
Position
complement(1693588..1694802)
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FDTGSTVTSNQILAIIEEGAVAAAAPAEEKKADAPAPAAAAPAAAPAPAAAAAPAAASKS
AADALPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVPM
TRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKA
AANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVTPVLRNVERQSFADVEQGIAD
YAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggcgaagcggtcaagcgcgacgagaatctggtcgacctggaa
accgacaaggtcgtgttggaagttccttcgccggtcgacggcgtactgaaggaaatcaag
ttcgataccggcagcacggtcaccagcaaccagattctggcgatcatcgaagaaggcgcc
gtggctgccgctgcaccggctgaagagaagaaggccgatgcaccggcgcctgccgctgct
gcgccggccgccgctccggcaccggctgccgccgccgcgcctgctgctgcgtccaagtcg
gctgccgatgcgctgccgccgggtgcgcgtttctccgcaatcacccagggcgtggacccg
tcgcaggtcgaaggcaccggccgtcgtggcgcggtcaccaaggaagacatcgtcaacttc
gccaaggccggcggcgtcggcaaggcctcgggcgcccgtccggaagagcgcgtgccgatg
acccgcgtgcgcaagaccattgccaagcgcctgatggagtccaagaactccaccgcgatg
ctgaccaccttcaacgaggtcaacctcgccaaggtgtcggccgcacgcaaggaactgcag
gacgagttccagaaggcacacggcatcaagctcggtttcatgagcttcttcgtcaaggcc
gccgccaacgcgctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatc
atctatcacggctacagcgacatctcgatcgcggtgtcgaccgacaagggcctggtcacg
ccggtgctgcgtaacgtcgagcgccagtcgttcgccgatgtcgagcaaggcattgccgac
tacgccgccaaggcgcgcgccggcaagctgggcctggacgaccttcagggtggcaccttc
accatcaccaacggcggcaccttcggctcgctgctgtccacgccgatcatcaacccgccg
cagagcgccatcctgggcatgcacgcgatcaaggaacgtccgatcgccgagaacggccag
gtcgtgatcgccccgatgatgtacctggcgctgtcctatgaccaccgcatcatcgacggc
aaggattcggtgcagttcctggtcgacatcaagaatcagctggaaaacccgggccggatg
ttgttcggtctgtga

DBGET integrated database retrieval system