KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1520Help
Entry
XACM_1520         CDS       T01616                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xax00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xax00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1711706..1712263
Genome map
AA seq 185 aa AA seqDB search
MLLNRLLALVLTGFFATSAFAAGTPVLDVEYRPLAGKTPINLNRTYGGKVVMVVNTASKC
GFTPQYEGLEALNQRFGSRGFTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTQATGVAPGWNFHKYLISRDGRVVAQFPSKIKPDDPSVLAAIEREL
KAPAH
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaatcgtctgctagctcttgtattgactggcttttttgcaacatccgcgttc
gctgccggcactccggtactggatgtggaataccggccgctggccggcaagacgccaatc
aacctgaaccgtacctacggcggcaaggtcgtcatggtggtcaacaccgccagcaagtgc
ggcttcaccccgcagtacgaggggctggaagcgctcaaccagcgcttcggcagccgcggc
ttcacggtgctgggttttccatccaacgatttccagggacaggaaccgggatcggagaaa
cagatccaggaattctgcacgctgacctatggggtgaagttcccgatgttcgaaaaggtc
catgtgctgggtgcgcaggcaacgccgctgtatcagcgcctgacccaggccactggcgtg
gcgccgggctggaacttccacaagtatctgatcagtcgcgatggccgggtggttgcgcag
ttccccagcaagatcaaacccgacgatccgagcgtgctggcagcaatcgaacgcgagctc
aaggcaccggcgcactga

DBGET integrated database retrieval system