KEGG   Xanthomonas alfalfae: XACM_1520Help
Entry
XACM_1520         CDS       T01616                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xax  Xanthomonas alfalfae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XACM_1520
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XACM_1520
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XACM_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1711706..1712263
Genome map
AA seq 185 aa AA seqDB search
MLLNRLLALVLTGFFATSAFAAGTPVLDVEYRPLAGKTPINLNRTYGGKVVMVVNTASKC
GFTPQYEGLEALNQRFGSRGFTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTQATGVAPGWNFHKYLISRDGRVVAQFPSKIKPDDPSVLAAIEREL
KAPAH
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaatcgtctgctagctcttgtattgactggcttttttgcaacatccgcgttc
gctgccggcactccggtactggatgtggaataccggccgctggccggcaagacgccaatc
aacctgaaccgtacctacggcggcaaggtcgtcatggtggtcaacaccgccagcaagtgc
ggcttcaccccgcagtacgaggggctggaagcgctcaaccagcgcttcggcagccgcggc
ttcacggtgctgggttttccatccaacgatttccagggacaggaaccgggatcggagaaa
cagatccaggaattctgcacgctgacctatggggtgaagttcccgatgttcgaaaaggtc
catgtgctgggtgcgcaggcaacgccgctgtatcagcgcctgacccaggccactggcgtg
gcgccgggctggaacttccacaagtatctgatcagtcgcgatggccgggtggttgcgcag
ttccccagcaagatcaaacccgacgatccgagcgtgctggcagcaatcgaacgcgagctc
aaggcaccggcgcactga

DBGET integrated database retrieval system