KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1704Help
Entry
XACM_1704         CDS       T01616                                 

Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xax00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xax02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913462..1913827)
Genome map
AA seq 121 aa AA seqDB search
MCAPLAGLMLAGALTMPSAYAADGAGVFLTECGECHSVKPGKNKKGPSLFGVAGRPAGTV
ADFGGYSDALKNSKWTWTPAQLKTYLSQSSSKALPGTKMKYDGLDDPKELDALIAYLNTL
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgccccgttggccggcctgatgctggcgggcgcactgaccatgccctcggcctac
gctgccgacggcgccggcgtcttcctcaccgaatgcggtgaatgccacagcgtcaaaccg
ggcaagaacaagaaaggtccgtcgctgttcggcgtggcaggccgccctgccggtaccgtc
gcagacttcggcggttattccgatgcgctcaagaacagcaagtggacctggactccggcc
cagctcaagacctatctgtcgcaatcctcgtccaaggcgctgccgggcaccaagatgaag
tacgacggcctggacgacccgaaggagctcgacgcactgatcgcctacctcaacactttg
aagtag

DBGET integrated database retrieval system