KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1704Help
Entry
XACM_1704         CDS       T01616                                 

Definition
(GenBank) cytochrome C2
  KO
K08738  cytochrome c
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax01100  Metabolic pathways
xax01120  Microbial metabolism in diverse environments
xax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xax00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XACM_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEO41984
UniProt: G2M1R6
Position
complement(1913462..1913827)
Genome map
AA seq 121 aa AA seqDB search
MCAPLAGLMLAGALTMPSAYAADGAGVFLTECGECHSVKPGKNKKGPSLFGVAGRPAGTV
ADFGGYSDALKNSKWTWTPAQLKTYLSQSSSKALPGTKMKYDGLDDPKELDALIAYLNTL
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgccccgttggccggcctgatgctggcgggcgcactgaccatgccctcggcctac
gctgccgacggcgccggcgtcttcctcaccgaatgcggtgaatgccacagcgtcaaaccg
ggcaagaacaagaaaggtccgtcgctgttcggcgtggcaggccgccctgccggtaccgtc
gcagacttcggcggttattccgatgcgctcaagaacagcaagtggacctggactccggcc
cagctcaagacctatctgtcgcaatcctcgtccaaggcgctgccgggcaccaagatgaag
tacgacggcctggacgacccgaaggagctcgacgcactgatcgcctacctcaacactttg
aagtag

DBGET integrated database retrieval system