KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1747Help
Entry
XACM_1747         CDS       T01616                                 

Definition
L-isoaspartate protein carboxylmethyltransferase type II
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1958215..1958892
Genome map
AA seq 225 aa AA seqDB search
MTPRLRLQPESVGIGMTSQRVRDRLVERLREAGIQDEATLNAMRTVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVTPAKVLEVGTGSGYQGAILAALGLEVYTVE
RIGDLLRQARKRFRHLGMNVRSKHDDGRIGWPEHGPYDAIVVTAAAPALVDALVDQLAVG
GRLVAPVGGPSSQSLVQLTRGADGAIEQQVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaggctgcgcctgcaaccggagtcggtcgggatcggcatgacctcgcaacgc
gtgcgcgaccgcctggtcgagcgcttgcgcgaggcgggcatccaggacgaggccacgctc
aacgcgatgcgcaccgtgccgcggcatctgttcatcgatgaagcgctggcctcgcgcgcc
tacgaagacactgcgctgccgatcggccatggccagaccatctcccagccctgggtggtg
gcgcgcatgaccgaagcggtgctgcaggtgaccccggccaaggtactcgaagtgggcacc
ggctccggctaccagggcgcgatcctggcggcgctggggctggaggtctacaccgtcgag
cgcatcggcgacctgctgcggcaggcgcgcaagcgcttccggcacctgggcatgaatgtg
cgcagcaagcacgacgacggccgcatcggctggcccgaacacgggccgtacgacgccatc
gtggtgaccgctgccgcaccggcgttggtcgatgcattggtcgaccagctggcggtcggc
gggcgcctggtcgcgccggtcggagggccttcctcgcaatcgttggtgcaactcacccgc
ggggccgatggcgccatcgaacaacaggttctggcgccggtcacgttcgtcccgctgttg
tcgggcatgctggattga

DBGET integrated database retrieval system