KEGG   Xanthomonas alfalfae: XACM_1754Help
Entry
XACM_1754         CDS       T01616                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xax  Xanthomonas alfalfae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XACM_1754 (folP)
Enzymes [BR:xax01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XACM_1754 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1964013..1964915
Genome map
AA seq 300 aa AA seqDB search
MFDTTLTLDCAGRSLRLDAPQVMGIVNVTPDSFSDGGQHATCEAAIAHGLALVEQGAAVL
DVGGESTRPGAAAVSVEEELQRVIPVIEALAQRTSVPISVDTFKPEVMRAAVAAGAGMIN
DVYALRSPGALEAASDLRVPVVLMHARSAPHAMQDAPHYDDIVGEVHRFLAERIFAAEMA
GIDKRQLVLDPGFGFDKTTPHNLTLLAQLRRLQEFGLPVLAGLSRKRSIGELTGRQIAAE
RVHGSVAAHLIAAQHGALLLRVHDVAATVDALKVWTAMAAIPVPRVSAPAAPTIRWPDED
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataccaccctcacactggattgcgccggccgcagcctgcgactggatgcaccg
caggtgatgggtatcgtcaatgtcacacccgattcgttctccgacggcggccagcatgcg
acctgcgaagcggcgatcgcgcatgggctggcgttggtggagcagggcgccgcggtgctg
gatgtcggtggtgaatccacccgtccgggcgctgcggcggtctcggttgaagaagaattg
cagcgggtcattccggtcatcgaggcgctggcccagcgcaccagcgtgccgatcagcgtg
gatacgttcaaaccggaggtcatgcgcgcggcggtcgcggccggcgccggcatgatcaac
gacgtctatgccctgcgttcgcccggtgcgctggaagcggcgtcggacctgcgcgtgcct
gtggtcttgatgcatgcgcgcagcgcgccacacgccatgcaggatgcgccgcactacgac
gatatcgtgggtgaagtgcaccggtttctggccgagcgcatcttcgctgccgagatggcc
ggcatcgacaagcgccagctggtcctggacccgggctttggcttcgataagaccaccccg
cacaacctcaccctgcttgcgcagctgcggcggctgcaggaattcggtttgccggtgctg
gccgggctgtcgcgcaaacgcagcatcggcgaactgaccgggcgccagatcgccgccgaa
cgtgtgcacggctcggtggccgcgcatctgatcgccgcacaacatggcgcgctgctgctg
cgcgtgcacgatgtggcggcaaccgtggatgcgttgaaggtatggacggcgatggcggcg
attcccgtaccgcgtgtcagcgcgcccgccgcgcccacgatccgttggccggacgaggac
tga

DBGET integrated database retrieval system