KEGG   Xanthomonas alfalfae: XACM_1849Help
Entry
XACM_1849         CDS       T01616                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xax  Xanthomonas alfalfae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XACM_1849 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XACM_1849 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XACM_1849 (thrC)
Enzymes [BR:xax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XACM_1849 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2088504..2089808
Genome map
AA seq 434 aa AA seqDB search
MFISTRGGAPAASLSQAIAAGLAPDGGLYVPQTLPPARTLVAGAGLADTATVLLQPFFEG
DALAAELPAICAEAFDFPAPLVELGTPGDYALELFHGPTAAFKDFGARFLAACLTRLRRA
EDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGSFDDCQAMVKQALNDAALQAQVPLSSANSISLGRLLPQMSYYAHAALEHHAASGSALN
LVVPTGNLGNALAAIIARALGVPLGRIALASNANHVLPVYFAGDAYAPQPSVATLANAMD
VGAPSNFERLRWLYNGDDAALREEFRALSVDDAAIRNTVQQRFARYGEVHCPHTATAVHV
LEQLRAEGAEGGTGDWAVAATAHPAKFEGVVEPLIGRAVEVPPALAALLQRPAHAEALAP
DYAALRQRLLADAA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctccacccgtggcggtgcccccgccgcaagcctgagccaggccatcgccgcc
gggctggcgcccgatggcggcctctacgtgccgcagaccctgccgcctgcgcgtacgctg
gttgcgggcgccggcctggccgacaccgccaccgtgctgctgcagccgtttttcgaaggt
gatgcgctggccgccgagctgcccgccatctgcgctgaagccttcgacttcccggcaccg
ctggttgagctgggtacgccgggcgattacgcgctggagctgtttcatggccccaccgct
gcgttcaaggatttcggtgcgcgcttcctggccgcctgcctgacccgcctgcgccgtgcc
gaagatcgtccgctcaccatcctggtcgccacctccggcgacaccggtgccgccgtggcc
gccgcgttccatcgccagcccggcctgcgcgtggtggtgctgtatccggacggccgcgtg
tcgccgcggcaggcgcatcaattggggtgtttcggcgacaacatccaggccctgcgcgtg
gccggctcgttcgacgactgccaggcaatggtcaagcaggccttgaacgatgccgcattg
caggcgcaggtgccgctgagttcggccaacagcatcagtctgggccggttgctgccgcag
atgagttactacgcacatgccgcgctggagcaccatgcagcctcgggcagcgcgctcaac
ctggtcgtgcctaccggtaacctgggcaacgcgctggcggcgatcatcgcgcgcgcgctc
ggggtgccattgggccgcatcgcgctggcgtccaacgccaatcacgtgttgccggtctat
ttcgcgggagatgcctacgcaccgcagcccagcgtagccacgctcgccaatgcgatggac
gtgggcgcgccgagcaatttcgagcggctgcgttggctctataacggcgacgatgccgcc
ttgcgcgaggaattccgggccttgtcggtggacgatgcggcgattcgcaacaccgtgcag
cagcgcttcgcccgctacggcgaggtgcattgcccgcataccgccaccgcggtgcatgtg
ctcgaacaattgcgtgccgaaggcgcggagggcggcactggcgactgggcggtagcggcc
accgcgcatccggccaagttcgagggggtggtggagccattgatcggccgcgcggtggag
gttccgccggcgctggccgcgctgctgcagcgcccggcgcatgccgaagcactggcgccg
gactacgcagcccttcggcagcgcttgcttgccgatgccgcctga

DBGET integrated database retrieval system