KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1849Help
Entry
XACM_1849         CDS       T01616                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xax01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xax00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:xax00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2088504..2089808
Genome map
AA seq 434 aa AA seqDB search
MFISTRGGAPAASLSQAIAAGLAPDGGLYVPQTLPPARTLVAGAGLADTATVLLQPFFEG
DALAAELPAICAEAFDFPAPLVELGTPGDYALELFHGPTAAFKDFGARFLAACLTRLRRA
EDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGSFDDCQAMVKQALNDAALQAQVPLSSANSISLGRLLPQMSYYAHAALEHHAASGSALN
LVVPTGNLGNALAAIIARALGVPLGRIALASNANHVLPVYFAGDAYAPQPSVATLANAMD
VGAPSNFERLRWLYNGDDAALREEFRALSVDDAAIRNTVQQRFARYGEVHCPHTATAVHV
LEQLRAEGAEGGTGDWAVAATAHPAKFEGVVEPLIGRAVEVPPALAALLQRPAHAEALAP
DYAALRQRLLADAA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctccacccgtggcggtgcccccgccgcaagcctgagccaggccatcgccgcc
gggctggcgcccgatggcggcctctacgtgccgcagaccctgccgcctgcgcgtacgctg
gttgcgggcgccggcctggccgacaccgccaccgtgctgctgcagccgtttttcgaaggt
gatgcgctggccgccgagctgcccgccatctgcgctgaagccttcgacttcccggcaccg
ctggttgagctgggtacgccgggcgattacgcgctggagctgtttcatggccccaccgct
gcgttcaaggatttcggtgcgcgcttcctggccgcctgcctgacccgcctgcgccgtgcc
gaagatcgtccgctcaccatcctggtcgccacctccggcgacaccggtgccgccgtggcc
gccgcgttccatcgccagcccggcctgcgcgtggtggtgctgtatccggacggccgcgtg
tcgccgcggcaggcgcatcaattggggtgtttcggcgacaacatccaggccctgcgcgtg
gccggctcgttcgacgactgccaggcaatggtcaagcaggccttgaacgatgccgcattg
caggcgcaggtgccgctgagttcggccaacagcatcagtctgggccggttgctgccgcag
atgagttactacgcacatgccgcgctggagcaccatgcagcctcgggcagcgcgctcaac
ctggtcgtgcctaccggtaacctgggcaacgcgctggcggcgatcatcgcgcgcgcgctc
ggggtgccattgggccgcatcgcgctggcgtccaacgccaatcacgtgttgccggtctat
ttcgcgggagatgcctacgcaccgcagcccagcgtagccacgctcgccaatgcgatggac
gtgggcgcgccgagcaatttcgagcggctgcgttggctctataacggcgacgatgccgcc
ttgcgcgaggaattccgggccttgtcggtggacgatgcggcgattcgcaacaccgtgcag
cagcgcttcgcccgctacggcgaggtgcattgcccgcataccgccaccgcggtgcatgtg
ctcgaacaattgcgtgccgaaggcgcggagggcggcactggcgactgggcggtagcggcc
accgcgcatccggccaagttcgagggggtggtggagccattgatcggccgcgcggtggag
gttccgccggcgctggccgcgctgctgcagcgcccggcgcatgccgaagcactggcgccg
gactacgcagcccttcggcagcgcttgcttgccgatgccgcctga

DBGET integrated database retrieval system