KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1855Help
Entry
XACM_1855         CDS       T01616                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xax01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:xax00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2094506..2095801
Genome map
AA seq 431 aa AA seqDB search
MKILDWSQLDGAARTDALTRPVQTVATQTRDAVAALIADVRARGDAALREITARFDGVSL
ESFAVGEADFAAAEAAVAPELRQAMQDAVARIDTFHRAGMSEGYAVETAPGVVCEKIVRP
IGRVGLYVPAGSAPLPSTALMLGVPARLAGCREVVLCTPPRKDGSVDPAVLVAAQLTGVR
RVFKLGGAQAIAAMAYGTESVPSCDKLFGPGNSYVTEAKQQVAQSGAAAIDMPAGPSEVL
VIADAGAQPAFVAADLLSQAEHGPDSQVLLLSDSDGLIDAVQVQLEVQLAQLSRADIARQ
ALAQSRMIKVQALDEAFAISNRYAPEHLILALREPRAWLAQVEAAGSVFLGDYTPEALGD
YCSGTNHVLPTSGAARAYSGVSVASFQNMVSVQAASKAGIDGIGQCALILARAEGLDAHA
NAVALRMGVAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctcgattggtcccaactcgacggtgccgcgcgaaccgatgcactgacccgc
ccggtgcagaccgtggccacgcagacgcgcgacgcagtggctgcattgattgccgatgtg
cgtgcacgcggcgatgccgccttgcgcgagatcaccgcgcgtttcgatggcgtatcgctg
gagagcttcgccgtgggcgaagccgacttcgctgccgccgaagcggccgtggcgccggag
ctgcgccaggccatgcaggatgcggtcgcacgcatcgacaccttccaccgcgccggcatg
agcgagggctatgcggtggaaaccgcgcccggcgtggtgtgcgaaaagatcgtgcggccg
atcggacgtgtgggtctgtacgtgccggctggcagtgcgccgttgccatcgaccgccttg
atgctgggcgtgccggcgcgtctggccggatgccgcgaggtggtgttgtgcacgccgccg
cgtaaggacggcagcgtggacccggcggtgctggtggccgcgcaactcaccggcgtgcgc
cgcgtgttcaagctcggtggcgcgcaggcgatcgcggcgatggcgtatggcaccgagtcg
gtacccagttgcgacaagctgttcggcccgggcaatagctatgtcaccgaagccaagcag
caggtggcccagtccggagcggcggcgatcgacatgccggccggcccctcggaggtcttg
gtgatcgccgatgcgggcgcgcagccggccttcgtggctgctgatctgttgtcgcaggcc
gaacacgggcccgattcgcaggtgctgttgctgtccgacagcgacgggttgatcgatgcg
gtgcaagtacagctggaagttcagcttgcgcaactgtcgcgtgccgacatcgcgcgccag
gcgctggcgcaatcgcggatgatcaaggtgcaggcgctggatgaggcgtttgcgatcagt
aatcgctatgcgccggagcacctgattcttgcgctgcgcgaaccgcgcgcgtggctggcg
caagtcgaagcggccggttcggtgtttcttggcgattacacgcccgaagcgcttggcgac
tactgcagcggcaccaatcatgtgctgccgaccagcggtgcggcgcgcgcctacagcggg
gtgagtgtggccagcttccagaatatggtcagcgtgcaggcagccagcaaggccggcatc
gacggcatcggtcaatgcgcattgatccttgcccgcgctgaggggctggatgcgcatgcc
aacgcggtggcgctgcgcatgggagtggcggcatga

DBGET integrated database retrieval system