KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2124Help
Entry
XACM_2124         CDS       T01616                                 

Definition
Cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Brite
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     XACM_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2435179..2436171)
Genome map
AA seq 330 aa AA seqDB search
MTQPPARARPDHRKWRWSPAPILKVALASAALLVMPLVPAAEIAAPSVRTGEPIHAIQPA
TGLDSRKVALGALLFNDRRLSGDNRVACTSCHHLASNGAAADAMTRMPGRATPAFNTPTV
FNATANFRLGWRGNFRSPEAQTASLLENPSVMRADIATVVGRLQQDTVLNQRFRAAYGRP
PDRAALFDAIAAYERSLVTPGSRFDLWLQGSDTALSAQELRGYTTFKSIGCISCHQGVNV
GGNLFQRSGIFAPAARHGTPILRVPSLRNVATTAPYFHDGSATTLPQAIKAMGTAQLGVT
LSPADVADIAAFLQTLTGKHQGRQLTAPAP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccgccggcgcgagccaggccagaccatcgcaaatggcgttggtcgccggcg
ccgatccttaaagtcgcgctcgcttctgcagcgttactcgtcatgccgctcgtgccggca
gctgaaattgcagccccgtcggtgcgcacaggcgagcccatccacgccatccagccagcg
accggcctggatagccgcaaggtcgcactcggcgcgctgctgttcaatgatcgccggctg
tcgggcgacaatcgcgttgcctgcacctcatgtcatcacctggccagcaacggtgctgcc
gccgatgcgatgacccgaatgcccgggcgcgcgacgccagcgttcaacacaccgaccgtc
ttcaatgccaccgcaaattttcgcctgggctggcgcggcaatttccgcagcccggaagcg
caaacggcgtcgttgctggaaaaccccagcgtcatgcgcgccgatatcgcgacggtggta
ggacgactgcaacaagacacggtgctcaatcagcgctttcgcgcggcctatggcaggcca
ccggatcgggccgcgctgttcgatgccatcgccgcctacgaacgctcgctggtcacgccg
ggcagtcgctttgatctctggctgcaaggcagcgacactgcgctcagcgcacaggagctg
cgcggctacaccaccttcaaatcgatcggctgcatctcctgccaccagggcgtcaacgtg
ggcggcaacctgttccagcgcagcggcatcttcgctcccgccgcacggcatggcaccccg
atcctgcgggttcccagcctgcgcaatgtcgcgaccaccgcgccctacttccacgacggc
agcgcgaccaccctgccccaggcaatcaaggccatgggtacggcgcaactgggcgtcaca
ctgagcccggcggatgtggccgacattgccgcattcctgcagacattgaccggcaagcac
caaggccggcagttgacggcgccggcgccgtga

DBGET integrated database retrieval system