KEGG   Xanthomonas alfalfae: XACM_2177Help
Entry
XACM_2177         CDS       T01616                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xax  Xanthomonas alfalfae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XACM_2177 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_2177 (glk)
   00052 Galactose metabolism
    XACM_2177 (glk)
   00500 Starch and sucrose metabolism
    XACM_2177 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XACM_2177 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XACM_2177 (glk)
   00524 Butirosin and neomycin biosynthesis
    XACM_2177 (glk)
Enzymes [BR:xax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XACM_2177 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2491069..2492076)
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADVDASVPLLDDTSREFAVVDFGSLGEAARYYLDQIGV
QATQGVFAVAGRVDGDEARITNHPWVISRSRTATMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIDQARNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRALSEIAGVDPGPLQPKDITARAAAGDPRS
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSKVPSLAVMHPHAGLLGAAAYAVDAQRQHPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccaagccggtgctggttgccgatatcggcggaaccaatgcgcgcttc
gcgctggccgatgtcgacgcttcggtgccgttgctggatgacacctcgcgcgaatttgcc
gtggtggacttcggttcgctgggcgaagccgcgcgctattacctcgaccagatcggcgtg
caggccacccagggcgtgttcgccgtggcaggccgcgtggatggcgacgaggcgcgcatc
accaaccatccctgggtgatctcgcgctcgcgcaccgccaccatgttgggtttcagtacc
ttgcatctgatcaacgactttgccgcgcaggccatggccatcagcctgctgcgcccgcag
gacgtggtgcaggtgggcggcgccagctggcggccggcgccgatcgatcaagcgcgcaac
tatggcgtgatcggcccgggcaccggcctgggcgtgggtggcctgatcatccgcaacggg
cgctgctttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gaaatccgcatcctggaaatcctgtccgagcagttcggccgggtctccaacgagcggctg
atctgcggccccggcctggtcaacatccatcgcgcgctcagcgagatcgccggcgtcgat
cccggcccgctgcaacccaaggatatcaccgcacgcgcggccgcgggcgacccgcggtcc
tcgcgcaccatcgatctgttctgcgccatcttcggtgcgatcgccggcgacatggtgctg
atgcagggcgcctgggacggcgtgttcctcaccggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggctttcgccagcgcttcgaacacaagggccgtttctccgcgatc
atgtcgaaggtgccatcgctggcggtcatgcacccgcatgccggcctgctgggcgccgcc
gcatacgcggtggatgcacaacgtcagcaccccggggagcagcgatga

DBGET integrated database retrieval system