KEGG   Xanthomonas alfalfae: XACM_2300Help
Entry
XACM_2300         CDS       T01616                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xax  Xanthomonas alfalfae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XACM_2300 (galU)
   00052 Galactose metabolism
    XACM_2300 (galU)
   00500 Starch and sucrose metabolism
    XACM_2300 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XACM_2300 (galU)
Enzymes [BR:xax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XACM_2300 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2620984..2621877)
Genome map
AA seq 297 aa AA seqDB search
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAEL
LKEEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILRNALAQADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacagtgccgaaagaaatgctgccaatcatcgacaagccattgatccag
tacgccgtcgacgaagccatccaggctggttgcgatacgctgatcttcgttaccaaccgc
tacaagcactccattgccgactacttcgacaaagcctatgagctcgagcagaagctggag
cgcgcaggcaagctggagcagctggagctggtgcgccatgcattgcccgagggcgttcgc
gccatttttgtcacgcaggcagaggcgctcggcctgggccatgcggtgttgtgtgccaag
gccgttgtcggtgacgagccgttcgcggtgttgctgccggacgatttgatgtggaaccgc
ggcgatgccgcgctgacccagatggccaatgtggccgaagcctcgggcggcagcgtgatc
gccgtggaagacgtgccgcacgacaagaccgccagctacggcatcgtttccaccgacgcg
ttcgacggccgcaagggccgcatcaacgcgatcgtcgaaaagcccaagccggaagtcgcg
ccaagcaatctggccgtggtcggtcgttacgtgctgagccccaagatcttcgacctgctc
gaagccaccggtgcaggcgcgggcggcgaaatccagctcactgatgcgattgccgagttg
ctgaaggaagagcaagtcgatgccttccgtttcgaaggtcgccgtttcgattgcggcgcg
cacatcggcctgatcgaagccaccgtgcatttcgcgcttgagcacgaaaagcatggcggc
ccagcgaaggaaatcctgcgcaatgcactggcccaggccgacgcgcgcggctga

DBGET integrated database retrieval system