KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2352Help
Entry
XACM_2352         CDS       T01616                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xax01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xax00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2680065..2681219)
Genome map
AA seq 384 aa AA seqDB search
MSTPASTLSPFTEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREL
VIVSSGAVAAGRAILPKAADVGAPIAARQALAALGQAQLIALWQRFFERPVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGFYSADPRSNPLARPLDDVPELTPEVLAMAGGSGSNVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSGDVVRALAQDRLRGTRIHAARTRIAARKYWLRHAPVEAGAILIDDGAAA
ALTGKGASLLPGGVAGAQGDFRRGDMVEIRLRDTAGDQCLARGVSQYSALDIRRIAGRHS
REIENVLGYSYGENVVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcctgccagcacgttgtcgccgtttaccgagcaggcgctgccgccgtggcgc
cgtgcggtgctcaaagtcggcagcagcctgctcgccgccgatggcggtggcctgtccccg
cgcttcgcgctgggtctggcgcagttcgtttccgccaatctggcagccgggcgcgagctg
gtgatcgtctcgtcgggcgcggtggccgctggtcgcgccatcctgcccaaagcggcggat
gtcggcgcgccgatcgcggcgcggcaggcactggccgccttgggccaagcgcagctgatt
gcgttatggcagcgctttttcgagcggccggtggcgcaggtactgctcacgcatgacgac
ctgcgcaaccgtcgccgctatctcaacgcgcgtgccaccttgggcgagttgctgcggctg
ggtgcgctgccggtgatcaacgaaaacgacaccgtctcggtggatgagttgaagctgggc
gataacgacaacctggccgcgatcgtggctgcgctggtcgatgccgacgcgttgttcatc
gccaccgacatcgatgggttttatagcgccgacccacgcagcaatccgctggcgcgcccg
ctcgacgatgtgcccgagctcacccctgaagtgctggcgatggccggcggcagcggcagc
aacgtggggaccggcggcatgcgcaccaaactggaagccgctgcaaaggccggtgcggcc
ggcatcgaaacctatctattcaacggccgaagtggcgatgtggtgcgcgccctggcgcag
gaccgcctgcgtggcacacgcatccacgccgcgcgcacgcgcatcgctgcgcgaaaatac
tggctgcggcacgcaccggtggaagcgggtgcgatcctcatcgacgacggcgccgcagcg
gccctgaccggcaagggcgcctcgctgttgccaggcggcgtggccggcgcgcagggcgat
tttcgtcgcggcgacatggtggagattcgtctgcgcgacaccgcgggcgaccagtgtctg
gcacgcggcgtcagccagtattcggccctggatatccgtcgtatcgcaggccgccactcg
cgcgagatcgagaacgtgctcggctacagttacggcgaaaacgtggtgcatcgcgatgat
ctggtgctgttgtag

DBGET integrated database retrieval system