KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2502Help
Entry
XACM_2502         CDS       T01616                                 

Gene name
egl4
Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xax00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2862691..2864451)
Genome map
AA seq 586 aa AA seqDB search
MTNFKTVLTSLMIVSPVLACAAETTGRQEAVAASDAIHVNQLGYLPGSAKLAIVGLPPQD
AAQRSDRFTVEDAQGRSVLQGTLQPAAMWSPAAQQARVADFSGLRAVGTYRLKVDGLPAS
ETFAINAHAYQPLVDAALKAFYFNRASTALPARYAGRYARAAGHLDTQVRIHPSAASATR
PTDSVISAPKGWYDAGDYNKYIVNSGISTYTLLAAYEQYPAFFRSKPLTIPDDAPGVPGI
LQEAWWNLDWMLAMQDPADGGVYHKLTDKQFDGLVMPDQATQQRYVVMKTTAATLDFAAV
MAVASRVYAPFEKQYPGLSARMMKASRAAWAWAKQHPDVIYHQPSDVRTGGYDDAHLDDE
FAWAAAELYIATGEDGFYDAMIARNVPATVPSWGNVGGLAWMSLAAHRDRLTPHADRARI
AREITGLAQQLADTWQSSAWRLAMNDSDFVWGSNAGVLNRAMMLLQGYRLTQQRQFLDAA
QSQLDYILGRNPLGLSFVTGIGKRTPMHIHHRPSEADGIEAPVPGWLVGGPQPGQQDAKE
CKVPYPSKRPALSYLDNFCSYSTNEVAINWNAPLVYVSAAIEASTR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgactaacttcaagactgtgctcaccagcctgatgatcgtttcgcccgtgctcgcctgc
gctgcggagaccaccggtaggcaggaggccgtggcggccagcgacgccatccacgtcaac
cagctgggctatctgccgggctcggcaaaactggcgatcgtcgggctgccgccgcaggac
gccgcgcagcgttcggaccgcttcaccgtcgaagatgcacagggacgcagcgtgttgcag
ggaaccctgcagccggccgcgatgtggtcgccggccgcacagcaggcgcgggtggcggat
ttttccgggctgcgtgcggtcggaacctatcggttgaaggtcgacgggctgccggcatcg
gagaccttcgccatcaacgcgcatgcctatcagcccctggtcgatgcagcgttgaaggcg
ttctacttcaaccgtgccagcaccgcgctgccggcacgctacgccgggcgctatgcgcgc
gcggccgggcacctggatacgcaggtgcgcatccatccgtccgcagcgtctgcaacgcgt
ccgaccgatagcgtgatcagcgcgcccaagggctggtacgacgcgggcgactacaacaag
tacatcgtcaattccggcatcagcacctacaccttgctggcggcctacgagcagtatccg
gcgttcttcaggtccaagccgctgaccatccccgacgatgcgcccggcgtgcccggcatc
ctgcaggaggcctggtggaatctggactggatgctcgccatgcaggacccggccgatggc
ggcgtgtaccacaagctcaccgacaagcagttcgatggcttggtgatgccggatcaggcc
acgcagcaacgctacgtggtgatgaagaccactgccgcgaccttggacttcgctgcggtg
atggccgttgccagtcgcgtatatgcgccatttgaaaagcagtatccggggctgtcggcg
cgcatgatgaaagcctcgcgggctgcgtgggcatgggcgaagcagcatccggacgtgatc
taccatcagcccagcgacgtgcgtaccggcggttacgacgatgcacacctggatgacgaa
ttcgcctgggcggcggccgagttgtacatcgccaccggcgaggatgggttctacgacgcg
atgatcgcgcgcaacgtgccggccaccgtgccctcatggggcaatgtcggtgggctggcc
tggatgtcgttggccgcgcatcgcgaccgactcacgccgcatgccgatcgcgcgcggatc
gcacgggagatcaccggactggcacaacagctggccgacacctggcagtcatcggcatgg
cggctggcgatgaacgacagcgatttcgtgtggggcagcaatgcaggggtgctcaaccgc
gcgatgatgctgctgcagggctaccggctgacgcagcagcggcaatttctggatgcggcg
caatcgcagctggactacatcctgggccgcaatccgctggggctgtcgttcgtgaccggg
ataggcaaacgcaccccgatgcatatccatcaccgaccctcagaggccgatgggatcgaa
gcgccggtgccgggttggctggttggcggcccgcagccggggcagcaggatgccaaggag
tgcaaggtgccgtatccctccaaacggccggcgttgtcgtacctggacaacttctgcagc
tattccaccaacgaggtggcgatcaactggaatgcgccgctggtgtatgtgagcgcggcg
atcgaggcgtcgacgcgctaa

DBGET integrated database retrieval system